Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4R5K9

Protein Details
Accession F4R5K9    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
138-167VVNSSPGQQKKKRNRPKKTGKKFKIPIPATHydrophilic
NLS Segment(s)
PositionSequence
147-162KKKRNRPKKTGKKFKI
Subcellular Location(s) nucl 20, cyto_nucl 13.5, mito 4
Family & Domain DBs
KEGG mlr:MELLADRAFT_89279  -  
Amino Acid Sequences MDRFLLRSPARHPNGKPKPPGSYSSIRPPSVSFPESQTYERELTVLNFVYQIVQLYRVYLFILFFRFYPNNQIYISYQSPTSKPSVSLTLCDTMSEEHTSSHLDLQTGTPDPSQISAAKIYEAILNQDHPIKLASDSVVNSSPGQQKKKRNRPKKTGKKFKIPIPATGELKTFIDHGSTCDAEGYPIYPNGETVFVREPTDQITNFGHIAYPHTQKTHGAKDGPWKTIWFKCLGVLHCEDDFCEYAAPPPTAEGKAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.73
3 0.76
4 0.71
5 0.73
6 0.69
7 0.69
8 0.64
9 0.61
10 0.57
11 0.59
12 0.61
13 0.53
14 0.5
15 0.48
16 0.47
17 0.47
18 0.43
19 0.34
20 0.31
21 0.35
22 0.37
23 0.37
24 0.33
25 0.3
26 0.3
27 0.28
28 0.24
29 0.2
30 0.18
31 0.2
32 0.18
33 0.14
34 0.13
35 0.13
36 0.13
37 0.12
38 0.12
39 0.09
40 0.11
41 0.1
42 0.11
43 0.11
44 0.11
45 0.11
46 0.1
47 0.1
48 0.09
49 0.11
50 0.11
51 0.1
52 0.16
53 0.17
54 0.17
55 0.24
56 0.25
57 0.25
58 0.25
59 0.27
60 0.23
61 0.27
62 0.28
63 0.21
64 0.21
65 0.2
66 0.21
67 0.21
68 0.22
69 0.17
70 0.17
71 0.18
72 0.23
73 0.21
74 0.22
75 0.23
76 0.22
77 0.21
78 0.2
79 0.19
80 0.13
81 0.15
82 0.15
83 0.12
84 0.1
85 0.1
86 0.12
87 0.12
88 0.13
89 0.12
90 0.1
91 0.1
92 0.1
93 0.12
94 0.12
95 0.12
96 0.1
97 0.09
98 0.09
99 0.1
100 0.11
101 0.09
102 0.09
103 0.1
104 0.1
105 0.09
106 0.09
107 0.09
108 0.09
109 0.08
110 0.09
111 0.08
112 0.08
113 0.09
114 0.11
115 0.1
116 0.09
117 0.09
118 0.09
119 0.08
120 0.09
121 0.08
122 0.08
123 0.08
124 0.1
125 0.1
126 0.1
127 0.1
128 0.14
129 0.2
130 0.24
131 0.3
132 0.36
133 0.45
134 0.55
135 0.67
136 0.73
137 0.78
138 0.83
139 0.87
140 0.92
141 0.93
142 0.94
143 0.94
144 0.9
145 0.9
146 0.86
147 0.82
148 0.81
149 0.71
150 0.66
151 0.62
152 0.6
153 0.51
154 0.47
155 0.4
156 0.3
157 0.29
158 0.23
159 0.16
160 0.11
161 0.1
162 0.09
163 0.1
164 0.12
165 0.12
166 0.12
167 0.12
168 0.12
169 0.11
170 0.11
171 0.1
172 0.08
173 0.09
174 0.1
175 0.09
176 0.1
177 0.1
178 0.13
179 0.12
180 0.13
181 0.16
182 0.16
183 0.19
184 0.19
185 0.18
186 0.19
187 0.24
188 0.21
189 0.19
190 0.2
191 0.2
192 0.2
193 0.19
194 0.17
195 0.13
196 0.17
197 0.19
198 0.23
199 0.23
200 0.24
201 0.26
202 0.3
203 0.37
204 0.4
205 0.41
206 0.38
207 0.39
208 0.48
209 0.53
210 0.51
211 0.46
212 0.41
213 0.41
214 0.44
215 0.44
216 0.37
217 0.31
218 0.33
219 0.38
220 0.37
221 0.36
222 0.35
223 0.35
224 0.32
225 0.32
226 0.27
227 0.25
228 0.24
229 0.19
230 0.17
231 0.13
232 0.17
233 0.22
234 0.22
235 0.18
236 0.2
237 0.23