Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4R3J7

Protein Details
Accession F4R3J7    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
233-253EQDSNRKERLKQKLEKIQVDIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 25, cyto_nucl 14
Family & Domain DBs
KEGG mlr:MELLADRAFT_101078  -  
Amino Acid Sequences MANINPASNQNQNHPITEQPPYQQSHPNYNHLPPQYQAQVYHHPSRPSSQPQSNSQHPNNNPSHGHLIPTPNPQLLQSQTSIPPGYQINPSSVHPQPPSQPIINQPAYNKMPNLPQHQVPPPSHPIMRPSQHQMAQHLMNPQAHIRSQRLIQQQQQIQHQQQMQRYEEIMMITDPLDSLNNRSLAARRYTSCHANMNSLLGNHWTVNAILKGDHKPSNKRKLSDPTDSNEPTEQDSNRKERLKQKLEKIQVDIEKSKKSHQLQLQMILDRSIPIQSESD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.4
3 0.37
4 0.41
5 0.37
6 0.33
7 0.37
8 0.38
9 0.4
10 0.44
11 0.45
12 0.5
13 0.51
14 0.54
15 0.53
16 0.54
17 0.58
18 0.53
19 0.51
20 0.41
21 0.43
22 0.41
23 0.38
24 0.37
25 0.34
26 0.4
27 0.44
28 0.52
29 0.5
30 0.47
31 0.47
32 0.48
33 0.51
34 0.51
35 0.53
36 0.52
37 0.53
38 0.58
39 0.64
40 0.68
41 0.7
42 0.66
43 0.66
44 0.61
45 0.65
46 0.59
47 0.57
48 0.5
49 0.45
50 0.46
51 0.37
52 0.37
53 0.31
54 0.34
55 0.33
56 0.37
57 0.35
58 0.3
59 0.29
60 0.28
61 0.28
62 0.25
63 0.23
64 0.18
65 0.19
66 0.2
67 0.22
68 0.21
69 0.18
70 0.17
71 0.16
72 0.17
73 0.18
74 0.17
75 0.17
76 0.19
77 0.2
78 0.23
79 0.24
80 0.27
81 0.24
82 0.26
83 0.27
84 0.3
85 0.33
86 0.28
87 0.28
88 0.28
89 0.35
90 0.34
91 0.32
92 0.28
93 0.32
94 0.33
95 0.33
96 0.29
97 0.23
98 0.26
99 0.3
100 0.35
101 0.31
102 0.3
103 0.33
104 0.37
105 0.41
106 0.36
107 0.36
108 0.34
109 0.34
110 0.33
111 0.3
112 0.29
113 0.3
114 0.32
115 0.29
116 0.31
117 0.33
118 0.35
119 0.35
120 0.33
121 0.31
122 0.29
123 0.28
124 0.25
125 0.22
126 0.19
127 0.19
128 0.18
129 0.15
130 0.15
131 0.16
132 0.15
133 0.14
134 0.15
135 0.21
136 0.28
137 0.3
138 0.34
139 0.39
140 0.4
141 0.42
142 0.46
143 0.44
144 0.38
145 0.39
146 0.38
147 0.35
148 0.36
149 0.37
150 0.33
151 0.29
152 0.29
153 0.25
154 0.22
155 0.18
156 0.15
157 0.1
158 0.08
159 0.07
160 0.06
161 0.05
162 0.05
163 0.06
164 0.06
165 0.08
166 0.11
167 0.12
168 0.12
169 0.13
170 0.16
171 0.18
172 0.22
173 0.23
174 0.21
175 0.25
176 0.28
177 0.32
178 0.32
179 0.35
180 0.32
181 0.33
182 0.32
183 0.29
184 0.27
185 0.22
186 0.2
187 0.15
188 0.15
189 0.11
190 0.11
191 0.1
192 0.09
193 0.11
194 0.11
195 0.1
196 0.1
197 0.14
198 0.17
199 0.21
200 0.27
201 0.3
202 0.4
203 0.5
204 0.59
205 0.63
206 0.62
207 0.65
208 0.7
209 0.71
210 0.71
211 0.66
212 0.6
213 0.62
214 0.61
215 0.56
216 0.47
217 0.41
218 0.35
219 0.36
220 0.32
221 0.31
222 0.36
223 0.4
224 0.46
225 0.5
226 0.53
227 0.57
228 0.66
229 0.69
230 0.71
231 0.75
232 0.78
233 0.82
234 0.8
235 0.75
236 0.72
237 0.67
238 0.65
239 0.61
240 0.56
241 0.54
242 0.51
243 0.53
244 0.54
245 0.53
246 0.56
247 0.56
248 0.61
249 0.59
250 0.66
251 0.65
252 0.6
253 0.56
254 0.48
255 0.41
256 0.31
257 0.27
258 0.2
259 0.15