Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4S9N4

Protein Details
Accession F4S9N4    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
2-21RYGWCVERRYRENNKKTPVTHydrophilic
39-63QTNNPKKNDNTKKTKVQQPQHRFDVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, mito_nucl 12.333, cyto_nucl 10.333, mito 6.5
Family & Domain DBs
KEGG mlr:MELLADRAFT_73567  -  
Amino Acid Sequences MRYGWCVERRYRENNKKTPVTDICATSHNNMNQKGRKAQTNNPKKNDNTKKTKVQQPQHRFDVERYTF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.81
3 0.78
4 0.73
5 0.72
6 0.64
7 0.59
8 0.52
9 0.45
10 0.38
11 0.34
12 0.34
13 0.27
14 0.29
15 0.27
16 0.29
17 0.3
18 0.35
19 0.36
20 0.38
21 0.42
22 0.39
23 0.42
24 0.42
25 0.47
26 0.51
27 0.58
28 0.63
29 0.63
30 0.67
31 0.64
32 0.7
33 0.73
34 0.72
35 0.71
36 0.69
37 0.75
38 0.77
39 0.82
40 0.81
41 0.81
42 0.82
43 0.82
44 0.83
45 0.8
46 0.77
47 0.7
48 0.63