Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

N4VZP8

Protein Details
Accession N4VZP8    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
47-69IHFATLKPEQKKKKETKGKGGKKBasic
NLS Segment(s)
PositionSequence
55-69EQKKKKETKGKGGKK
Subcellular Location(s) E.R. 7, cyto 6, plas 6, mito 5, nucl 1, extr 1, golg 1
Family & Domain DBs
Amino Acid Sequences MGQFDWFRSIGATPEAVAVLNDQPILFTILLIVLVAVMLQITLLWYIHFATLKPEQKKKKETKGKGGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.1
4 0.09
5 0.09
6 0.08
7 0.08
8 0.08
9 0.07
10 0.07
11 0.07
12 0.09
13 0.08
14 0.07
15 0.06
16 0.06
17 0.06
18 0.06
19 0.05
20 0.02
21 0.02
22 0.02
23 0.02
24 0.01
25 0.01
26 0.01
27 0.01
28 0.02
29 0.02
30 0.03
31 0.03
32 0.04
33 0.04
34 0.06
35 0.07
36 0.07
37 0.11
38 0.2
39 0.28
40 0.35
41 0.44
42 0.52
43 0.61
44 0.72
45 0.77
46 0.8
47 0.83
48 0.85
49 0.88