Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4SAL8

Protein Details
Accession F4SAL8    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
24-57DSLPTRTTTSRRRRPAKTKSPEAHKKPTRKRARFBasic
NLS Segment(s)
PositionSequence
34-56RRRRPAKTKSPEAHKKPTRKRAR
Subcellular Location(s) nucl 25.5, cyto_nucl 15
Family & Domain DBs
KEGG mlr:MELLADRAFT_73627  -  
Amino Acid Sequences MMRSGLRRSQRRSTSPSESSDHGDSLPTRTTTSRRRRPAKTKSPEAHKKPTRKRARFDDDEDNEDNEDEDNDEFNTNHEHTNTTFEPTPNMSNYCELGMQWGLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.68
3 0.65
4 0.58
5 0.51
6 0.49
7 0.43
8 0.36
9 0.27
10 0.24
11 0.21
12 0.2
13 0.21
14 0.17
15 0.17
16 0.18
17 0.25
18 0.33
19 0.43
20 0.5
21 0.57
22 0.64
23 0.72
24 0.8
25 0.85
26 0.86
27 0.84
28 0.84
29 0.81
30 0.83
31 0.84
32 0.8
33 0.8
34 0.76
35 0.78
36 0.77
37 0.81
38 0.82
39 0.78
40 0.78
41 0.78
42 0.79
43 0.74
44 0.7
45 0.7
46 0.61
47 0.59
48 0.54
49 0.44
50 0.36
51 0.3
52 0.25
53 0.14
54 0.12
55 0.08
56 0.07
57 0.07
58 0.07
59 0.08
60 0.08
61 0.09
62 0.12
63 0.13
64 0.14
65 0.14
66 0.15
67 0.15
68 0.22
69 0.22
70 0.23
71 0.25
72 0.24
73 0.26
74 0.28
75 0.3
76 0.27
77 0.28
78 0.25
79 0.25
80 0.26
81 0.24
82 0.21
83 0.17
84 0.18