Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

N4V8T1

Protein Details
Accession N4V8T1    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
2-24GNGAKAQQKRERNQKDAKNKGSQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 9.5, cyto_nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039713  At2g23090-like  
IPR039438  At2g23090-like_Znf  
IPR007513  SERF-like_N  
IPR026939  ZNF706/At2g23090_sf  
Pfam View protein in Pfam  
PF04419  4F5  
PF12907  zf-met2  
Amino Acid Sequences MGNGAKAQQKRERNQKDAKNKGSQLKVNAAAKDIQCQICKATFLKTTKAPALTEHAENKHSKGLPECFPSFIPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.82
3 0.84
4 0.85
5 0.82
6 0.8
7 0.76
8 0.75
9 0.72
10 0.66
11 0.59
12 0.55
13 0.53
14 0.48
15 0.43
16 0.36
17 0.33
18 0.29
19 0.28
20 0.26
21 0.22
22 0.19
23 0.19
24 0.19
25 0.16
26 0.18
27 0.15
28 0.15
29 0.19
30 0.21
31 0.24
32 0.26
33 0.29
34 0.3
35 0.32
36 0.28
37 0.24
38 0.28
39 0.27
40 0.28
41 0.3
42 0.29
43 0.31
44 0.32
45 0.32
46 0.33
47 0.32
48 0.3
49 0.32
50 0.35
51 0.37
52 0.43
53 0.43
54 0.39