Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N4V212

Protein Details
Accession N4V212    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
344-375TAKAYPPVEDEKKKKKKQPKDKGSRYPGGAKKBasic
NLS Segment(s)
PositionSequence
355-375KKKKKKQPKDKGSRYPGGAKK
Subcellular Location(s) cyto 21.5, cyto_nucl 13.166, cyto_mito 11.999, cyto_pero 11.999
Family & Domain DBs
InterPro View protein in InterPro  
IPR002305  aa-tRNA-synth_Ic  
IPR014729  Rossmann-like_a/b/a_fold  
IPR002307  Tyr-tRNA-ligase  
IPR023617  Tyr-tRNA-ligase_arc/euk-type  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005524  F:ATP binding  
GO:0004831  F:tyrosine-tRNA ligase activity  
GO:0006437  P:tyrosyl-tRNA aminoacylation  
Pfam View protein in Pfam  
PF00579  tRNA-synt_1b  
Amino Acid Sequences MAEGAQANERFALIQENLAEVMNPEIIEKILAEGRNPKIYWGTATTGRPHCGYFVPAIKLAQFLAAGCEMTVLLADIHGFLDNLKAPIELVEQRAKFYKFAITHILQAVGVSTEKLKFVLGSSYQKSPEYIMDIYKMSSLISERDAKKAGAEVVKQSDNAPMSGLLYPVLQVCDEEHLGVDAQFGGMDQRKLFAAATEWLPKIGYKVRAHLLNPMVPGLNGGKMSSSDPDSKIDLLDAPELVQKKLRKAECVPKVAEGNGVLSFVEYVLLPAAALKGKKEFRVERERDGLEPLVYTSIADMHEDYKNDVLTPQLLKPAVTKALNELLAPIQAAFQASQEWQDITAKAYPPVEDEKKKKKKQPKDKGSRYPGGAKKEDGATKETELPVRPAEESK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.16
4 0.17
5 0.16
6 0.16
7 0.11
8 0.12
9 0.1
10 0.1
11 0.09
12 0.09
13 0.09
14 0.09
15 0.09
16 0.1
17 0.13
18 0.14
19 0.16
20 0.23
21 0.27
22 0.34
23 0.34
24 0.33
25 0.33
26 0.33
27 0.35
28 0.31
29 0.31
30 0.3
31 0.33
32 0.4
33 0.41
34 0.42
35 0.39
36 0.36
37 0.33
38 0.29
39 0.28
40 0.26
41 0.27
42 0.28
43 0.29
44 0.29
45 0.27
46 0.26
47 0.24
48 0.19
49 0.13
50 0.1
51 0.11
52 0.1
53 0.1
54 0.09
55 0.09
56 0.07
57 0.07
58 0.07
59 0.05
60 0.04
61 0.04
62 0.04
63 0.04
64 0.05
65 0.05
66 0.05
67 0.05
68 0.08
69 0.09
70 0.1
71 0.1
72 0.09
73 0.09
74 0.1
75 0.14
76 0.14
77 0.16
78 0.23
79 0.23
80 0.25
81 0.3
82 0.3
83 0.27
84 0.26
85 0.3
86 0.24
87 0.26
88 0.32
89 0.28
90 0.3
91 0.3
92 0.29
93 0.21
94 0.2
95 0.17
96 0.11
97 0.1
98 0.07
99 0.07
100 0.07
101 0.08
102 0.08
103 0.08
104 0.08
105 0.08
106 0.12
107 0.15
108 0.21
109 0.23
110 0.26
111 0.28
112 0.28
113 0.28
114 0.25
115 0.22
116 0.2
117 0.18
118 0.16
119 0.16
120 0.16
121 0.16
122 0.15
123 0.14
124 0.09
125 0.09
126 0.09
127 0.08
128 0.11
129 0.18
130 0.19
131 0.22
132 0.23
133 0.23
134 0.22
135 0.22
136 0.23
137 0.19
138 0.19
139 0.19
140 0.22
141 0.22
142 0.22
143 0.21
144 0.21
145 0.18
146 0.17
147 0.14
148 0.1
149 0.11
150 0.11
151 0.11
152 0.07
153 0.06
154 0.07
155 0.07
156 0.07
157 0.05
158 0.05
159 0.05
160 0.07
161 0.07
162 0.07
163 0.06
164 0.06
165 0.07
166 0.06
167 0.06
168 0.04
169 0.04
170 0.03
171 0.03
172 0.05
173 0.06
174 0.07
175 0.07
176 0.08
177 0.08
178 0.09
179 0.09
180 0.07
181 0.07
182 0.08
183 0.1
184 0.12
185 0.12
186 0.12
187 0.12
188 0.12
189 0.13
190 0.16
191 0.21
192 0.19
193 0.22
194 0.25
195 0.28
196 0.29
197 0.32
198 0.3
199 0.24
200 0.24
201 0.21
202 0.18
203 0.15
204 0.15
205 0.1
206 0.09
207 0.07
208 0.07
209 0.07
210 0.07
211 0.09
212 0.09
213 0.11
214 0.13
215 0.14
216 0.16
217 0.17
218 0.17
219 0.16
220 0.15
221 0.13
222 0.11
223 0.1
224 0.09
225 0.08
226 0.1
227 0.11
228 0.11
229 0.15
230 0.16
231 0.21
232 0.28
233 0.3
234 0.32
235 0.38
236 0.48
237 0.51
238 0.54
239 0.5
240 0.46
241 0.45
242 0.4
243 0.35
244 0.25
245 0.19
246 0.14
247 0.13
248 0.1
249 0.08
250 0.08
251 0.06
252 0.06
253 0.04
254 0.04
255 0.04
256 0.04
257 0.04
258 0.04
259 0.05
260 0.07
261 0.08
262 0.08
263 0.15
264 0.18
265 0.22
266 0.29
267 0.33
268 0.4
269 0.5
270 0.54
271 0.53
272 0.57
273 0.55
274 0.48
275 0.47
276 0.4
277 0.29
278 0.25
279 0.19
280 0.13
281 0.12
282 0.11
283 0.07
284 0.08
285 0.08
286 0.08
287 0.09
288 0.11
289 0.13
290 0.14
291 0.16
292 0.16
293 0.16
294 0.15
295 0.15
296 0.13
297 0.14
298 0.16
299 0.16
300 0.19
301 0.19
302 0.19
303 0.21
304 0.24
305 0.26
306 0.25
307 0.24
308 0.23
309 0.28
310 0.28
311 0.26
312 0.23
313 0.18
314 0.18
315 0.17
316 0.13
317 0.08
318 0.08
319 0.09
320 0.08
321 0.07
322 0.09
323 0.09
324 0.11
325 0.12
326 0.12
327 0.12
328 0.15
329 0.15
330 0.16
331 0.2
332 0.2
333 0.21
334 0.22
335 0.21
336 0.22
337 0.31
338 0.37
339 0.41
340 0.49
341 0.58
342 0.68
343 0.77
344 0.83
345 0.85
346 0.88
347 0.9
348 0.92
349 0.92
350 0.93
351 0.95
352 0.96
353 0.94
354 0.91
355 0.85
356 0.84
357 0.79
358 0.76
359 0.69
360 0.6
361 0.55
362 0.54
363 0.53
364 0.45
365 0.42
366 0.37
367 0.37
368 0.4
369 0.39
370 0.36
371 0.34
372 0.35
373 0.35
374 0.34