Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A484FLJ0

Protein Details
Accession A0A484FLJ0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
58-85LICLCFPRRQEKRQNRVTHKSPRPHLRCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10.5, mito 9, cyto_nucl 9, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MLSRDKSDGLIHSLAYMKRQGGSTLRAPGKEPLLLRLLLRISSTVFAFRDDSLQPWPLICLCFPRRQEKRQNRVTHKSPRPHLRCLIRRHLAAAAVIDSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.22
3 0.22
4 0.18
5 0.19
6 0.2
7 0.21
8 0.2
9 0.24
10 0.26
11 0.32
12 0.34
13 0.32
14 0.34
15 0.34
16 0.32
17 0.31
18 0.27
19 0.21
20 0.21
21 0.21
22 0.19
23 0.19
24 0.17
25 0.14
26 0.14
27 0.11
28 0.1
29 0.1
30 0.1
31 0.09
32 0.09
33 0.1
34 0.1
35 0.1
36 0.12
37 0.11
38 0.12
39 0.12
40 0.14
41 0.12
42 0.11
43 0.12
44 0.1
45 0.1
46 0.09
47 0.15
48 0.17
49 0.24
50 0.27
51 0.37
52 0.43
53 0.51
54 0.62
55 0.66
56 0.73
57 0.75
58 0.83
59 0.82
60 0.84
61 0.84
62 0.84
63 0.82
64 0.82
65 0.81
66 0.82
67 0.78
68 0.76
69 0.76
70 0.76
71 0.75
72 0.74
73 0.75
74 0.71
75 0.67
76 0.62
77 0.56
78 0.47
79 0.4
80 0.33