Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

N4US57

Protein Details
Accession N4US57    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
64-88QAYKDCKKEWFERRKEERKKNGAWWHydrophilic
NLS Segment(s)
PositionSequence
77-83RKEERKK
Subcellular Location(s) nucl 18.5, cyto_nucl 12.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009069  Cys_alpha_HP_mot_SF  
PROSITE View protein in PROSITE  
PS51808  CHCH  
Amino Acid Sequences MSSQEPPQAPAPEKVDEAFKESNRKFDAKSKSEYFDPCQEFAQRSIRCLHRNGGDRSMCGDFFQAYKDCKKEWFERRKEERKKNGAWW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.32
3 0.27
4 0.3
5 0.29
6 0.28
7 0.36
8 0.35
9 0.41
10 0.4
11 0.41
12 0.38
13 0.42
14 0.48
15 0.43
16 0.49
17 0.46
18 0.45
19 0.47
20 0.47
21 0.43
22 0.42
23 0.4
24 0.34
25 0.32
26 0.3
27 0.28
28 0.27
29 0.32
30 0.24
31 0.23
32 0.27
33 0.3
34 0.31
35 0.32
36 0.33
37 0.31
38 0.38
39 0.4
40 0.43
41 0.39
42 0.37
43 0.38
44 0.36
45 0.29
46 0.22
47 0.2
48 0.12
49 0.12
50 0.15
51 0.15
52 0.16
53 0.22
54 0.24
55 0.24
56 0.29
57 0.35
58 0.41
59 0.48
60 0.56
61 0.6
62 0.69
63 0.78
64 0.84
65 0.89
66 0.91
67 0.91
68 0.89