Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A484FMR0

Protein Details
Accession A0A484FMR0    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
20-43ASSARIKRNRKSSQIKFKVRCQRHHydrophilic
NLS Segment(s)
PositionSequence
16-31RRKDASSARIKRNRKS
76-77PK
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002675  Ribosomal_L38e  
IPR038464  Ribosomal_L38e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01781  Ribosomal_L38e  
Amino Acid Sequences MPQEIGDIKKFIEIARRKDASSARIKRNRKSSQIKFKVRCQRHLYTLVLKDSDKAEKLKQSLPPQLQLKDVPKKNPKGGKASA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.42
3 0.43
4 0.42
5 0.47
6 0.49
7 0.47
8 0.51
9 0.52
10 0.53
11 0.61
12 0.67
13 0.68
14 0.75
15 0.75
16 0.74
17 0.76
18 0.76
19 0.78
20 0.82
21 0.85
22 0.79
23 0.81
24 0.82
25 0.75
26 0.73
27 0.69
28 0.62
29 0.57
30 0.57
31 0.5
32 0.46
33 0.45
34 0.38
35 0.32
36 0.29
37 0.25
38 0.23
39 0.23
40 0.19
41 0.18
42 0.2
43 0.24
44 0.27
45 0.31
46 0.36
47 0.4
48 0.47
49 0.47
50 0.52
51 0.52
52 0.5
53 0.49
54 0.48
55 0.49
56 0.51
57 0.53
58 0.55
59 0.6
60 0.66
61 0.72
62 0.75
63 0.73