Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A484GBB2

Protein Details
Accession A0A484GBB2    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
64-86STSWPVARYRRHHHDRPKDASVSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 9, nucl 8, cyto 6, plas 2, extr 2
Family & Domain DBs
Amino Acid Sequences MLMLLVRSEDAIRRLAAQLLPLTTTWCRGAFVFAKLYYDHHRHHTKKQYALISISALPTSASTSTSWPVARYRRHHHDRPKDASVSIYIEICIEG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.18
3 0.18
4 0.17
5 0.17
6 0.16
7 0.16
8 0.15
9 0.17
10 0.14
11 0.16
12 0.15
13 0.14
14 0.14
15 0.13
16 0.18
17 0.17
18 0.19
19 0.2
20 0.18
21 0.19
22 0.18
23 0.21
24 0.22
25 0.25
26 0.25
27 0.29
28 0.38
29 0.4
30 0.48
31 0.56
32 0.56
33 0.56
34 0.6
35 0.55
36 0.48
37 0.46
38 0.38
39 0.29
40 0.24
41 0.19
42 0.13
43 0.1
44 0.08
45 0.07
46 0.07
47 0.06
48 0.07
49 0.07
50 0.09
51 0.11
52 0.13
53 0.14
54 0.14
55 0.2
56 0.26
57 0.33
58 0.39
59 0.48
60 0.56
61 0.64
62 0.72
63 0.77
64 0.81
65 0.83
66 0.83
67 0.8
68 0.72
69 0.64
70 0.57
71 0.49
72 0.41
73 0.33
74 0.25
75 0.18