Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A484FZK7

Protein Details
Accession A0A484FZK7    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
47-70KYFSRPSRIPRLPQWRKRLRALCPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, nucl 5, cyto 2
Family & Domain DBs
Amino Acid Sequences MRRPTVTAAPCLPFLPYPVRRCHYIDAFELSITSPSPNPTARTPGQKYFSRPSRIPRLPQWRKRLRALCPLI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.26
3 0.29
4 0.32
5 0.38
6 0.41
7 0.43
8 0.46
9 0.48
10 0.44
11 0.4
12 0.37
13 0.34
14 0.31
15 0.28
16 0.24
17 0.19
18 0.15
19 0.12
20 0.1
21 0.06
22 0.07
23 0.1
24 0.11
25 0.13
26 0.14
27 0.2
28 0.22
29 0.3
30 0.34
31 0.38
32 0.42
33 0.44
34 0.48
35 0.51
36 0.57
37 0.55
38 0.53
39 0.55
40 0.6
41 0.63
42 0.63
43 0.64
44 0.68
45 0.72
46 0.78
47 0.81
48 0.8
49 0.81
50 0.85
51 0.83
52 0.79