Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A484FI35

Protein Details
Accession A0A484FI35   
Localization Confidence Low
Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
104-132WTQKKVTSLKSKTSRKHNKEYNKARARYPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10.5, mito 9, cyto_nucl 8.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019371  KxDL_dom  
Gene Ontology GO:0005768  C:endosome  
Pfam View protein in Pfam  
PF10241  KxDL  
Amino Acid Sequences MSTHYNAYSLPMPIHNHKADTRWPTRATPVATAATLRDRFAQTFDPIPLDRNIAVQAQTSGKLNAKHRELLELQKKAQARLAKTRERFNEGYRDAQDVRADLEWTQKKVTSLKSKTSRKHNKEYNKARARYPSPEF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.35
3 0.36
4 0.37
5 0.39
6 0.42
7 0.46
8 0.46
9 0.45
10 0.47
11 0.45
12 0.49
13 0.5
14 0.45
15 0.39
16 0.37
17 0.32
18 0.29
19 0.27
20 0.23
21 0.24
22 0.22
23 0.2
24 0.2
25 0.2
26 0.2
27 0.22
28 0.24
29 0.19
30 0.21
31 0.2
32 0.2
33 0.19
34 0.21
35 0.19
36 0.17
37 0.15
38 0.14
39 0.15
40 0.12
41 0.12
42 0.1
43 0.11
44 0.1
45 0.11
46 0.11
47 0.11
48 0.13
49 0.17
50 0.21
51 0.25
52 0.26
53 0.29
54 0.28
55 0.31
56 0.3
57 0.34
58 0.37
59 0.34
60 0.33
61 0.33
62 0.34
63 0.31
64 0.33
65 0.29
66 0.25
67 0.32
68 0.39
69 0.43
70 0.45
71 0.52
72 0.52
73 0.55
74 0.53
75 0.46
76 0.48
77 0.43
78 0.44
79 0.38
80 0.39
81 0.33
82 0.33
83 0.3
84 0.21
85 0.21
86 0.17
87 0.16
88 0.12
89 0.21
90 0.23
91 0.24
92 0.26
93 0.25
94 0.27
95 0.31
96 0.39
97 0.41
98 0.42
99 0.5
100 0.59
101 0.66
102 0.72
103 0.78
104 0.81
105 0.79
106 0.84
107 0.84
108 0.85
109 0.87
110 0.9
111 0.9
112 0.89
113 0.84
114 0.79
115 0.79
116 0.74