Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A484F8Y4

Protein Details
Accession A0A484F8Y4    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
194-219GTSHSLKKDKKAGGKKKRKAECDANEBasic
232-257VDDAVPRKKKERKLLRHEGNRWSNVKBasic
NLS Segment(s)
PositionSequence
199-212LKKDKKAGGKKKRK
236-248VPRKKKERKLLRH
Subcellular Location(s) cyto 9.5, cyto_mito 8.833, nucl 8.5, mito_nucl 8.333, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR006735  Rtf2  
IPR027799  Rtf2_RING-finger  
IPR013083  Znf_RING/FYVE/PHD  
Gene Ontology GO:0005634  C:nucleus  
GO:1902979  P:mitotic DNA replication termination  
Pfam View protein in Pfam  
PF04641  Rtf2  
CDD cd16653  RING-like_Rtf2  
Amino Acid Sequences MGNDGGSIPKRRELVKEAARALTVSELKANALESLGHAWSHDPLTTDPLGKENIVSDWRGRIYNYETILQNLMPSDEAPPAVPDSQELTFASTGIKSLRDIVKLKFHQHTTPGSKSVVWTCPISLKELGPSVKAVYLVPCGHVFAEVAIKEIQESVCPECSESFERGNVVPILSADEGDLKRLAQRIDNLKAAGTSHSLKKDKKAGGKKKRKAECDANEGVEGEAAQKRRAVDDAVPRKKKERKLLRHEGNRWSNVKNPTPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.5
3 0.55
4 0.54
5 0.52
6 0.5
7 0.44
8 0.38
9 0.34
10 0.27
11 0.2
12 0.19
13 0.18
14 0.18
15 0.18
16 0.18
17 0.12
18 0.11
19 0.1
20 0.09
21 0.11
22 0.11
23 0.11
24 0.1
25 0.11
26 0.12
27 0.13
28 0.13
29 0.12
30 0.13
31 0.17
32 0.19
33 0.2
34 0.18
35 0.2
36 0.2
37 0.18
38 0.17
39 0.14
40 0.15
41 0.15
42 0.16
43 0.15
44 0.17
45 0.19
46 0.2
47 0.19
48 0.2
49 0.22
50 0.26
51 0.27
52 0.27
53 0.26
54 0.26
55 0.27
56 0.23
57 0.19
58 0.14
59 0.12
60 0.09
61 0.08
62 0.09
63 0.08
64 0.09
65 0.08
66 0.09
67 0.1
68 0.11
69 0.1
70 0.09
71 0.12
72 0.12
73 0.13
74 0.12
75 0.12
76 0.12
77 0.12
78 0.12
79 0.09
80 0.09
81 0.08
82 0.09
83 0.07
84 0.11
85 0.14
86 0.17
87 0.2
88 0.22
89 0.3
90 0.32
91 0.37
92 0.37
93 0.37
94 0.35
95 0.36
96 0.41
97 0.38
98 0.37
99 0.35
100 0.31
101 0.29
102 0.28
103 0.28
104 0.24
105 0.19
106 0.17
107 0.15
108 0.18
109 0.18
110 0.19
111 0.17
112 0.15
113 0.14
114 0.17
115 0.17
116 0.13
117 0.13
118 0.11
119 0.11
120 0.11
121 0.1
122 0.08
123 0.1
124 0.1
125 0.11
126 0.1
127 0.1
128 0.1
129 0.1
130 0.09
131 0.06
132 0.09
133 0.07
134 0.09
135 0.09
136 0.08
137 0.08
138 0.09
139 0.09
140 0.07
141 0.09
142 0.09
143 0.11
144 0.11
145 0.12
146 0.11
147 0.15
148 0.17
149 0.17
150 0.17
151 0.15
152 0.17
153 0.16
154 0.18
155 0.15
156 0.12
157 0.1
158 0.09
159 0.11
160 0.1
161 0.1
162 0.07
163 0.12
164 0.12
165 0.13
166 0.13
167 0.1
168 0.12
169 0.15
170 0.16
171 0.14
172 0.2
173 0.26
174 0.3
175 0.33
176 0.31
177 0.28
178 0.28
179 0.26
180 0.21
181 0.17
182 0.16
183 0.19
184 0.26
185 0.32
186 0.34
187 0.39
188 0.47
189 0.5
190 0.57
191 0.63
192 0.66
193 0.72
194 0.81
195 0.83
196 0.85
197 0.87
198 0.84
199 0.82
200 0.81
201 0.77
202 0.74
203 0.7
204 0.62
205 0.54
206 0.48
207 0.39
208 0.28
209 0.21
210 0.15
211 0.14
212 0.14
213 0.14
214 0.16
215 0.17
216 0.18
217 0.2
218 0.21
219 0.23
220 0.33
221 0.43
222 0.52
223 0.58
224 0.59
225 0.67
226 0.72
227 0.75
228 0.75
229 0.75
230 0.75
231 0.79
232 0.88
233 0.89
234 0.92
235 0.9
236 0.89
237 0.87
238 0.84
239 0.77
240 0.69
241 0.66
242 0.63