Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N4VDP6

Protein Details
Accession N4VDP6   
Localization Confidence High
Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
19-46QGGPNDGAAKNKKRKRNNKDEKVTSSNLHydrophilic
85-149ADEETPKASKKQKKEKKEKAPKPSAEEEEEQQQTPKSEKKEKRDKKEKKEKREKAHHDKKQAATDBasic
NLS Segment(s)
PositionSequence
28-36KNKKRKRNN
57-108KTKEGGKRRKSEGASEETPKKKEAEVKEADEETPKASKKQKKEKKEKAPKPS
119-144PKSEKKEKRDKKEKKEKREKAHHDKK
Subcellular Location(s) nucl 14, cyto_nucl 12.333, cyto 9.5, mito_nucl 8.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR007823  RRP8  
IPR042036  RRP8_N  
IPR029063  SAM-dependent_MTases_sf  
Gene Ontology GO:0005730  C:nucleolus  
GO:0008168  F:methyltransferase activity  
GO:0032259  P:methylation  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF05148  Methyltransf_8  
CDD cd02440  AdoMet_MTases  
Amino Acid Sequences MFAVPGWSVSADALKSQTQGGPNDGAAKNKKRKRNNKDEKVTSSNLADLYENVIGGKTKEGGKRRKSEGASEETPKKKEAEVKEADEETPKASKKQKKEKKEKAPKPSAEEEEEQQQTPKSEKKEKRDKKEKKEKREKAHHDKKQAATDEQPSEQQNKATPKDDSKKKAKEAAAAIAASVPPMPPAPAKLTPLQASMRQKLISARFRHLNETLYTRPSAEAYQLFEDSPEMFSEYHEGFRRQVGVWPENPVDGYIRDIKQRARQRTPHRGAPPSRNPNAPAALPRTDGTCVIADLGCGDARLAATLAPEAQKLRLDIRSYDLHSPAKYVTKADIANLPLADGSVDVAIFCLALMGTNWIDFIEEAYRILHWKGELWVAEIKSRFGPVRAKNAPVAHSVGNRKKQATAAAAAPKKTKGGDPEETAADRMALAVEVDGQKDRRGETDVSAFVDALRKRGFVLQGEGEGNKGAVDLSNKMFVKMHFVKAAVPTKGKGLIAARAAGFVEKEKKQKRFVWDTEDDKVDENNILKPCLYKIR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.18
4 0.21
5 0.23
6 0.25
7 0.27
8 0.27
9 0.26
10 0.33
11 0.33
12 0.37
13 0.41
14 0.49
15 0.56
16 0.61
17 0.71
18 0.74
19 0.83
20 0.87
21 0.9
22 0.91
23 0.92
24 0.94
25 0.94
26 0.91
27 0.87
28 0.8
29 0.71
30 0.61
31 0.53
32 0.42
33 0.34
34 0.26
35 0.19
36 0.19
37 0.16
38 0.15
39 0.12
40 0.12
41 0.12
42 0.12
43 0.13
44 0.12
45 0.18
46 0.25
47 0.35
48 0.44
49 0.53
50 0.6
51 0.65
52 0.71
53 0.68
54 0.7
55 0.68
56 0.66
57 0.62
58 0.61
59 0.63
60 0.6
61 0.59
62 0.52
63 0.47
64 0.43
65 0.46
66 0.45
67 0.46
68 0.47
69 0.5
70 0.53
71 0.53
72 0.49
73 0.44
74 0.38
75 0.31
76 0.3
77 0.27
78 0.28
79 0.36
80 0.43
81 0.51
82 0.61
83 0.69
84 0.74
85 0.84
86 0.89
87 0.91
88 0.94
89 0.93
90 0.93
91 0.94
92 0.88
93 0.84
94 0.81
95 0.75
96 0.69
97 0.62
98 0.53
99 0.5
100 0.46
101 0.39
102 0.32
103 0.29
104 0.25
105 0.27
106 0.3
107 0.3
108 0.39
109 0.47
110 0.56
111 0.65
112 0.74
113 0.81
114 0.86
115 0.89
116 0.9
117 0.94
118 0.93
119 0.93
120 0.95
121 0.93
122 0.93
123 0.93
124 0.93
125 0.93
126 0.93
127 0.9
128 0.88
129 0.87
130 0.81
131 0.78
132 0.71
133 0.62
134 0.56
135 0.54
136 0.48
137 0.41
138 0.39
139 0.33
140 0.33
141 0.31
142 0.28
143 0.27
144 0.31
145 0.33
146 0.33
147 0.34
148 0.4
149 0.48
150 0.55
151 0.58
152 0.61
153 0.65
154 0.67
155 0.72
156 0.65
157 0.62
158 0.56
159 0.52
160 0.45
161 0.37
162 0.32
163 0.24
164 0.21
165 0.15
166 0.12
167 0.07
168 0.05
169 0.05
170 0.06
171 0.06
172 0.09
173 0.14
174 0.16
175 0.19
176 0.21
177 0.24
178 0.24
179 0.27
180 0.27
181 0.28
182 0.31
183 0.31
184 0.31
185 0.28
186 0.28
187 0.3
188 0.36
189 0.38
190 0.35
191 0.37
192 0.41
193 0.42
194 0.45
195 0.42
196 0.37
197 0.31
198 0.33
199 0.3
200 0.26
201 0.25
202 0.21
203 0.2
204 0.18
205 0.17
206 0.14
207 0.13
208 0.13
209 0.15
210 0.15
211 0.14
212 0.13
213 0.13
214 0.11
215 0.1
216 0.08
217 0.08
218 0.07
219 0.07
220 0.1
221 0.1
222 0.13
223 0.15
224 0.16
225 0.15
226 0.16
227 0.18
228 0.15
229 0.18
230 0.2
231 0.21
232 0.21
233 0.24
234 0.24
235 0.22
236 0.21
237 0.18
238 0.13
239 0.1
240 0.12
241 0.13
242 0.13
243 0.16
244 0.18
245 0.2
246 0.28
247 0.36
248 0.41
249 0.45
250 0.52
251 0.6
252 0.69
253 0.71
254 0.71
255 0.68
256 0.68
257 0.65
258 0.66
259 0.66
260 0.63
261 0.61
262 0.54
263 0.51
264 0.46
265 0.42
266 0.34
267 0.27
268 0.22
269 0.21
270 0.2
271 0.19
272 0.17
273 0.16
274 0.16
275 0.14
276 0.1
277 0.09
278 0.08
279 0.08
280 0.07
281 0.06
282 0.07
283 0.05
284 0.04
285 0.04
286 0.04
287 0.04
288 0.04
289 0.04
290 0.04
291 0.04
292 0.04
293 0.05
294 0.05
295 0.06
296 0.07
297 0.08
298 0.09
299 0.1
300 0.12
301 0.15
302 0.16
303 0.16
304 0.2
305 0.22
306 0.24
307 0.26
308 0.26
309 0.25
310 0.24
311 0.24
312 0.22
313 0.23
314 0.21
315 0.19
316 0.17
317 0.19
318 0.19
319 0.19
320 0.21
321 0.18
322 0.19
323 0.17
324 0.16
325 0.11
326 0.11
327 0.1
328 0.06
329 0.05
330 0.04
331 0.03
332 0.03
333 0.03
334 0.03
335 0.03
336 0.03
337 0.03
338 0.02
339 0.03
340 0.03
341 0.05
342 0.05
343 0.05
344 0.06
345 0.05
346 0.06
347 0.06
348 0.07
349 0.06
350 0.06
351 0.07
352 0.07
353 0.08
354 0.09
355 0.09
356 0.09
357 0.08
358 0.1
359 0.11
360 0.13
361 0.13
362 0.15
363 0.19
364 0.18
365 0.22
366 0.21
367 0.21
368 0.18
369 0.2
370 0.18
371 0.18
372 0.26
373 0.27
374 0.37
375 0.38
376 0.4
377 0.43
378 0.45
379 0.44
380 0.38
381 0.36
382 0.29
383 0.31
384 0.38
385 0.41
386 0.46
387 0.48
388 0.46
389 0.45
390 0.45
391 0.44
392 0.39
393 0.34
394 0.31
395 0.37
396 0.38
397 0.39
398 0.39
399 0.34
400 0.32
401 0.31
402 0.28
403 0.26
404 0.31
405 0.34
406 0.36
407 0.38
408 0.39
409 0.39
410 0.36
411 0.29
412 0.22
413 0.16
414 0.12
415 0.09
416 0.06
417 0.05
418 0.04
419 0.07
420 0.08
421 0.09
422 0.12
423 0.13
424 0.15
425 0.17
426 0.18
427 0.17
428 0.21
429 0.21
430 0.22
431 0.27
432 0.27
433 0.27
434 0.27
435 0.24
436 0.21
437 0.26
438 0.22
439 0.21
440 0.21
441 0.19
442 0.2
443 0.25
444 0.27
445 0.23
446 0.29
447 0.26
448 0.28
449 0.3
450 0.28
451 0.24
452 0.21
453 0.18
454 0.12
455 0.1
456 0.07
457 0.07
458 0.1
459 0.12
460 0.14
461 0.22
462 0.22
463 0.24
464 0.26
465 0.24
466 0.32
467 0.33
468 0.36
469 0.31
470 0.32
471 0.33
472 0.39
473 0.47
474 0.42
475 0.39
476 0.35
477 0.36
478 0.39
479 0.36
480 0.32
481 0.27
482 0.28
483 0.28
484 0.3
485 0.27
486 0.24
487 0.24
488 0.21
489 0.19
490 0.19
491 0.24
492 0.27
493 0.37
494 0.45
495 0.52
496 0.59
497 0.65
498 0.7
499 0.73
500 0.74
501 0.73
502 0.73
503 0.71
504 0.69
505 0.66
506 0.57
507 0.48
508 0.42
509 0.34
510 0.3
511 0.26
512 0.26
513 0.25
514 0.25
515 0.24
516 0.25