Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1D8PDX3

Protein Details
Accession A0A1D8PDX3    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
90-116HSDQSRRGRSRSREKKKVDTKPHVISLBasic
NLS Segment(s)
PositionSequence
95-106RRGRSRSREKKK
Subcellular Location(s) nucl 20.5, cyto_nucl 14, cyto 6.5
Family & Domain DBs
KEGG cal:CAALFM_C106750WA  -  
Amino Acid Sequences MPNESIDNSGEVVFSQPNIDQKPPPPPPTSNTNFLTHVRSRSPSRSVSPYAYRTRSDDRQPIAYSGDNNTIIRETARSELITRHQLQNVHSDQSRRGRSRSREKKKVDTKPHVISLMGFDTTTTLKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.1
3 0.11
4 0.17
5 0.2
6 0.23
7 0.24
8 0.28
9 0.38
10 0.43
11 0.47
12 0.46
13 0.46
14 0.46
15 0.52
16 0.53
17 0.49
18 0.46
19 0.43
20 0.42
21 0.4
22 0.43
23 0.37
24 0.36
25 0.32
26 0.33
27 0.34
28 0.36
29 0.39
30 0.36
31 0.37
32 0.39
33 0.39
34 0.4
35 0.41
36 0.42
37 0.44
38 0.43
39 0.4
40 0.39
41 0.42
42 0.42
43 0.42
44 0.42
45 0.38
46 0.39
47 0.38
48 0.35
49 0.31
50 0.27
51 0.22
52 0.18
53 0.18
54 0.15
55 0.15
56 0.14
57 0.12
58 0.12
59 0.11
60 0.1
61 0.09
62 0.09
63 0.1
64 0.1
65 0.11
66 0.13
67 0.17
68 0.23
69 0.24
70 0.25
71 0.27
72 0.29
73 0.29
74 0.35
75 0.33
76 0.31
77 0.3
78 0.29
79 0.31
80 0.38
81 0.46
82 0.41
83 0.44
84 0.5
85 0.57
86 0.67
87 0.73
88 0.75
89 0.76
90 0.81
91 0.86
92 0.88
93 0.89
94 0.88
95 0.87
96 0.85
97 0.82
98 0.79
99 0.7
100 0.6
101 0.5
102 0.43
103 0.35
104 0.27
105 0.2
106 0.14
107 0.15
108 0.16