Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S2IZH6

Protein Details
Accession S2IZH6   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
8-33QSTLNLPKSRRNTRQQQQQKLKSVHDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23, mito 2, cyto 2, cyto_mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR007218  DNA_pol_delta_4  
Gene Ontology GO:0006260  P:DNA replication  
GO:0000731  P:DNA synthesis involved in DNA repair  
Pfam View protein in Pfam  
PF04081  DNA_pol_delta_4  
Amino Acid Sequences MPPNKQSQSTLNLPKSRRNTRQQQQQKLKSVHDESIVQIGKHKEPRQTTDASYKFEIHQEHLDETDKLLRAFDLNYAFGPCVGIKRLDRWERAYNLGLNPLTDVKDILTKDKTGKYKESVFHQFRMI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.67
3 0.71
4 0.71
5 0.71
6 0.73
7 0.76
8 0.85
9 0.86
10 0.88
11 0.89
12 0.89
13 0.88
14 0.82
15 0.75
16 0.71
17 0.64
18 0.56
19 0.47
20 0.39
21 0.31
22 0.34
23 0.32
24 0.24
25 0.25
26 0.25
27 0.27
28 0.34
29 0.37
30 0.35
31 0.38
32 0.44
33 0.44
34 0.44
35 0.42
36 0.44
37 0.43
38 0.41
39 0.38
40 0.34
41 0.3
42 0.31
43 0.29
44 0.21
45 0.21
46 0.19
47 0.17
48 0.17
49 0.18
50 0.14
51 0.14
52 0.15
53 0.13
54 0.11
55 0.11
56 0.09
57 0.09
58 0.09
59 0.11
60 0.1
61 0.1
62 0.1
63 0.11
64 0.11
65 0.1
66 0.1
67 0.08
68 0.08
69 0.08
70 0.11
71 0.12
72 0.17
73 0.26
74 0.3
75 0.34
76 0.38
77 0.44
78 0.43
79 0.47
80 0.45
81 0.39
82 0.34
83 0.37
84 0.31
85 0.24
86 0.23
87 0.2
88 0.19
89 0.16
90 0.15
91 0.1
92 0.15
93 0.16
94 0.2
95 0.21
96 0.22
97 0.27
98 0.34
99 0.4
100 0.41
101 0.46
102 0.47
103 0.52
104 0.54
105 0.58
106 0.61
107 0.59