Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4RWJ5

Protein Details
Accession F4RWJ5    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-46MKQSKKQNDQKTEQSKKQNDQKNKTIKKTKQSNKGNDHKQNKKHNDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 11.833, mito 4
Family & Domain DBs
KEGG mlr:MELLADRAFT_90327  -  
Amino Acid Sequences MKQSKKQNDQKTEQSKKQNDQKNKTIKKTKQSNKGNDHKQNKKHNDDQFQAKPTKQSTETIKIKKAIKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.8
3 0.79
4 0.81
5 0.8
6 0.8
7 0.78
8 0.79
9 0.8
10 0.8
11 0.8
12 0.82
13 0.78
14 0.78
15 0.81
16 0.8
17 0.79
18 0.8
19 0.81
20 0.8
21 0.83
22 0.82
23 0.81
24 0.82
25 0.8
26 0.8
27 0.81
28 0.8
29 0.78
30 0.77
31 0.75
32 0.74
33 0.7
34 0.7
35 0.65
36 0.63
37 0.59
38 0.52
39 0.49
40 0.44
41 0.45
42 0.38
43 0.38
44 0.4
45 0.46
46 0.55
47 0.56
48 0.59
49 0.6