Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S2JIP9

Protein Details
Accession S2JIP9    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
16-36VDKNKNKRYNQYMKYHRERVCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, mito 5
Family & Domain DBs
Amino Acid Sequences MAKKQNKQKIPASVYVDKNKNKRYNQYMKYHRERVCMQRATRRIIERRALLTNMPIVLREQALKDADKLLSLRKGRTINSTLSNHVDILAHLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.69
3 0.69
4 0.66
5 0.68
6 0.7
7 0.71
8 0.69
9 0.71
10 0.73
11 0.75
12 0.76
13 0.78
14 0.79
15 0.79
16 0.82
17 0.81
18 0.74
19 0.69
20 0.66
21 0.64
22 0.63
23 0.6
24 0.55
25 0.54
26 0.55
27 0.54
28 0.54
29 0.52
30 0.48
31 0.46
32 0.48
33 0.41
34 0.4
35 0.37
36 0.33
37 0.27
38 0.23
39 0.19
40 0.16
41 0.13
42 0.1
43 0.09
44 0.09
45 0.09
46 0.09
47 0.09
48 0.11
49 0.13
50 0.13
51 0.13
52 0.15
53 0.14
54 0.15
55 0.15
56 0.16
57 0.22
58 0.24
59 0.25
60 0.29
61 0.33
62 0.33
63 0.4
64 0.4
65 0.37
66 0.42
67 0.43
68 0.41
69 0.41
70 0.41
71 0.33
72 0.31
73 0.26