Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S2J240

Protein Details
Accession S2J240    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
45-79ASFLVKRKSHSKSKKKSKSKSKSKKSSDCSKRSCPHydrophilic
NLS Segment(s)
PositionSequence
50-69KRKSHSKSKKKSKSKSKSKK
Subcellular Location(s) extr 11, E.R. 7, plas 5, mito 2
Family & Domain DBs
Amino Acid Sequences MKSTVFSTAIFLLVITAFLIESSNAFSHPLDMIVSSVDRHSRNVASFLVKRKSHSKSKKKSKSKSKSKKSSDCSKRSCPMKLKPCPKDCPQSCGYLNSPDPCCPLLGKPTCPDY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.06
3 0.05
4 0.04
5 0.04
6 0.05
7 0.04
8 0.05
9 0.07
10 0.08
11 0.08
12 0.09
13 0.09
14 0.1
15 0.1
16 0.1
17 0.08
18 0.08
19 0.08
20 0.07
21 0.08
22 0.07
23 0.08
24 0.11
25 0.12
26 0.13
27 0.16
28 0.17
29 0.17
30 0.19
31 0.19
32 0.2
33 0.23
34 0.28
35 0.33
36 0.32
37 0.34
38 0.39
39 0.43
40 0.49
41 0.56
42 0.61
43 0.64
44 0.75
45 0.83
46 0.86
47 0.9
48 0.91
49 0.91
50 0.92
51 0.92
52 0.92
53 0.92
54 0.91
55 0.91
56 0.87
57 0.87
58 0.86
59 0.84
60 0.8
61 0.77
62 0.75
63 0.71
64 0.71
65 0.68
66 0.68
67 0.69
68 0.72
69 0.74
70 0.76
71 0.79
72 0.79
73 0.77
74 0.79
75 0.71
76 0.68
77 0.59
78 0.57
79 0.51
80 0.49
81 0.45
82 0.41
83 0.42
84 0.41
85 0.42
86 0.37
87 0.38
88 0.33
89 0.32
90 0.27
91 0.26
92 0.3
93 0.33
94 0.36