Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S2IVL4

Protein Details
Accession S2IVL4    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
147-168TTTSSNGKKRKKKLAAAPSPPSHydrophilic
NLS Segment(s)
PositionSequence
153-167GKKRKKKLAAAPSPP
Subcellular Location(s) nucl 18, cyto 4, mito 2, extr 2, cyto_pero 2
Family & Domain DBs
Amino Acid Sequences MISSPTEMIDFGVAALPPASSEGDLNIASFVLEVRNRLSRLESAHAEISRLRAALAESESARQALEAQLSRLSAPPVSSSSAAAPPPPPQLPKAVSFASVAAAPPPPPQLPKAVSFASVAAASSAPVSAPRRSSPVLSTSVSAASTTTTSSNGKKRKKKLAAAPSPPSIKKATATVSRLFGPQSDIPSGYQFVYMSIARRRPLQEIRRTLQGINLNNFRVLDIQYPVPNYNAFERSWLLSPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.07
4 0.07
5 0.08
6 0.09
7 0.07
8 0.08
9 0.08
10 0.11
11 0.11
12 0.11
13 0.1
14 0.09
15 0.08
16 0.08
17 0.07
18 0.09
19 0.1
20 0.11
21 0.14
22 0.19
23 0.2
24 0.21
25 0.24
26 0.23
27 0.27
28 0.31
29 0.3
30 0.28
31 0.32
32 0.31
33 0.3
34 0.27
35 0.26
36 0.21
37 0.19
38 0.15
39 0.11
40 0.12
41 0.13
42 0.14
43 0.14
44 0.13
45 0.14
46 0.15
47 0.14
48 0.13
49 0.1
50 0.1
51 0.09
52 0.12
53 0.12
54 0.13
55 0.14
56 0.14
57 0.15
58 0.15
59 0.14
60 0.11
61 0.11
62 0.11
63 0.12
64 0.14
65 0.13
66 0.13
67 0.14
68 0.16
69 0.16
70 0.15
71 0.15
72 0.15
73 0.18
74 0.2
75 0.19
76 0.18
77 0.23
78 0.24
79 0.25
80 0.27
81 0.23
82 0.22
83 0.21
84 0.2
85 0.16
86 0.13
87 0.11
88 0.08
89 0.08
90 0.07
91 0.08
92 0.1
93 0.1
94 0.11
95 0.12
96 0.17
97 0.18
98 0.21
99 0.23
100 0.22
101 0.22
102 0.21
103 0.2
104 0.16
105 0.13
106 0.1
107 0.07
108 0.06
109 0.05
110 0.04
111 0.04
112 0.03
113 0.06
114 0.09
115 0.1
116 0.12
117 0.13
118 0.16
119 0.18
120 0.19
121 0.18
122 0.19
123 0.21
124 0.2
125 0.2
126 0.17
127 0.16
128 0.15
129 0.13
130 0.1
131 0.07
132 0.06
133 0.07
134 0.07
135 0.08
136 0.1
137 0.15
138 0.23
139 0.32
140 0.41
141 0.49
142 0.57
143 0.66
144 0.73
145 0.77
146 0.79
147 0.81
148 0.82
149 0.81
150 0.78
151 0.72
152 0.68
153 0.6
154 0.53
155 0.44
156 0.35
157 0.28
158 0.26
159 0.26
160 0.28
161 0.31
162 0.31
163 0.31
164 0.31
165 0.31
166 0.28
167 0.23
168 0.21
169 0.2
170 0.2
171 0.2
172 0.2
173 0.2
174 0.21
175 0.22
176 0.17
177 0.16
178 0.13
179 0.11
180 0.13
181 0.13
182 0.16
183 0.21
184 0.25
185 0.25
186 0.31
187 0.33
188 0.37
189 0.47
190 0.52
191 0.56
192 0.6
193 0.63
194 0.65
195 0.65
196 0.57
197 0.54
198 0.51
199 0.47
200 0.46
201 0.47
202 0.4
203 0.39
204 0.39
205 0.33
206 0.28
207 0.24
208 0.2
209 0.18
210 0.21
211 0.22
212 0.25
213 0.26
214 0.26
215 0.25
216 0.24
217 0.27
218 0.26
219 0.23
220 0.23
221 0.25
222 0.26