Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S2J9D4

Protein Details
Accession S2J9D4   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
97-130LAEAPKGGRKQRKEKKNREKKFRGVRKSKKPRKEBasic
NLS Segment(s)
PositionSequence
88-130PKHRLVRIGLAEAPKGGRKQRKEKKNREKKFRGVRKSKKPRKE
Subcellular Location(s) mito 18, cyto 6.5, cyto_nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MADAAVTIRTRKFLTNRLLQRKQMVVDVIHPGLANVSKDELRSKIGKMYKAEKEVVSVFGFKTHFGGGKTTGFALIYDNVEALKKFEPKHRLVRIGLAEAPKGGRKQRKEKKNREKKFRGVRKSKKPRKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.49
3 0.58
4 0.66
5 0.71
6 0.68
7 0.68
8 0.64
9 0.57
10 0.5
11 0.42
12 0.33
13 0.29
14 0.3
15 0.24
16 0.21
17 0.19
18 0.16
19 0.14
20 0.15
21 0.12
22 0.09
23 0.11
24 0.11
25 0.12
26 0.14
27 0.14
28 0.16
29 0.18
30 0.18
31 0.23
32 0.26
33 0.3
34 0.32
35 0.38
36 0.39
37 0.41
38 0.42
39 0.35
40 0.33
41 0.3
42 0.28
43 0.21
44 0.17
45 0.13
46 0.14
47 0.14
48 0.11
49 0.12
50 0.1
51 0.11
52 0.1
53 0.12
54 0.11
55 0.12
56 0.12
57 0.11
58 0.1
59 0.09
60 0.08
61 0.08
62 0.08
63 0.07
64 0.07
65 0.07
66 0.07
67 0.07
68 0.07
69 0.08
70 0.1
71 0.14
72 0.16
73 0.23
74 0.3
75 0.35
76 0.45
77 0.5
78 0.52
79 0.49
80 0.53
81 0.49
82 0.45
83 0.42
84 0.34
85 0.28
86 0.23
87 0.24
88 0.21
89 0.22
90 0.27
91 0.32
92 0.4
93 0.51
94 0.6
95 0.7
96 0.78
97 0.86
98 0.89
99 0.92
100 0.94
101 0.94
102 0.94
103 0.93
104 0.93
105 0.92
106 0.92
107 0.92
108 0.92
109 0.93
110 0.94