Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S2J2F9

Protein Details
Accession S2J2F9   
Localization Confidence Medium
Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
28-61KVQKSSSSPKSKSKKRTHKKRKSKPSKAGSSQTDHydrophilic
NLS Segment(s)
PositionSequence
35-54SPKSKSKKRTHKKRKSKPSK
Subcellular Location(s) nucl 12.5, mito 12, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MTKSTDSSMPCLKIRLKLNTIRTDDLTKVQKSSSSPKSKSKKRTHKKRKSKPSKAGSSQTDVVNSDKLVTPVKPMNRTFYWTSERIESTKLILRTVILAN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.47
3 0.48
4 0.51
5 0.58
6 0.62
7 0.63
8 0.59
9 0.54
10 0.49
11 0.44
12 0.43
13 0.41
14 0.34
15 0.3
16 0.28
17 0.28
18 0.28
19 0.35
20 0.38
21 0.41
22 0.45
23 0.53
24 0.63
25 0.69
26 0.76
27 0.79
28 0.8
29 0.82
30 0.89
31 0.91
32 0.92
33 0.95
34 0.95
35 0.96
36 0.96
37 0.95
38 0.94
39 0.92
40 0.9
41 0.84
42 0.81
43 0.72
44 0.66
45 0.58
46 0.48
47 0.4
48 0.32
49 0.26
50 0.2
51 0.17
52 0.13
53 0.11
54 0.12
55 0.13
56 0.12
57 0.15
58 0.2
59 0.26
60 0.31
61 0.32
62 0.37
63 0.37
64 0.42
65 0.41
66 0.41
67 0.42
68 0.37
69 0.39
70 0.36
71 0.37
72 0.34
73 0.33
74 0.28
75 0.26
76 0.3
77 0.28
78 0.24
79 0.22
80 0.21