Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4S2H7

Protein Details
Accession F4S2H7    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
124-157GKSKLEFKWQKARDKKRAKIRQRKRRENEDDGDGBasic
NLS Segment(s)
PositionSequence
125-149KSKLEFKWQKARDKKRAKIRQRKRR
Subcellular Location(s) nucl 15, mito 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR000352  Pep_chain_release_fac_I  
IPR045853  Pep_chain_release_fac_I_sf  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0003747  F:translation release factor activity  
KEGG mlr:MELLADRAFT_92698  -  
Pfam View protein in Pfam  
PF00472  RF-1  
Amino Acid Sequences MNQSFRLILNSLNQIQIRSIQTTSSLFLPSKLPKIQKLNESDLIEEFVRGSGPGGQCINSLSFSQNMLMDDSCILKKTNFISVSLIHKPTGIRVQCHAQRSRESNRKEARKILSEKVDLFLNPGKSKLEFKWQKARDKKRAKIRQRKRRENEDDGDGDETSSKPSIKEEKTDTIKGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.27
3 0.3
4 0.28
5 0.25
6 0.24
7 0.19
8 0.21
9 0.22
10 0.23
11 0.19
12 0.19
13 0.16
14 0.17
15 0.22
16 0.23
17 0.28
18 0.32
19 0.34
20 0.39
21 0.47
22 0.51
23 0.53
24 0.56
25 0.56
26 0.57
27 0.54
28 0.48
29 0.4
30 0.37
31 0.3
32 0.23
33 0.17
34 0.1
35 0.09
36 0.08
37 0.08
38 0.1
39 0.1
40 0.13
41 0.13
42 0.13
43 0.13
44 0.14
45 0.15
46 0.11
47 0.12
48 0.1
49 0.1
50 0.11
51 0.11
52 0.11
53 0.11
54 0.11
55 0.1
56 0.09
57 0.09
58 0.1
59 0.09
60 0.09
61 0.09
62 0.08
63 0.11
64 0.12
65 0.18
66 0.17
67 0.18
68 0.19
69 0.2
70 0.25
71 0.25
72 0.25
73 0.18
74 0.19
75 0.18
76 0.18
77 0.23
78 0.19
79 0.17
80 0.19
81 0.25
82 0.28
83 0.34
84 0.36
85 0.32
86 0.36
87 0.4
88 0.48
89 0.5
90 0.49
91 0.53
92 0.57
93 0.62
94 0.61
95 0.61
96 0.57
97 0.57
98 0.58
99 0.54
100 0.52
101 0.47
102 0.44
103 0.39
104 0.35
105 0.26
106 0.25
107 0.23
108 0.21
109 0.19
110 0.19
111 0.19
112 0.2
113 0.24
114 0.23
115 0.3
116 0.33
117 0.39
118 0.49
119 0.54
120 0.62
121 0.69
122 0.78
123 0.78
124 0.81
125 0.84
126 0.85
127 0.89
128 0.9
129 0.91
130 0.91
131 0.92
132 0.92
133 0.95
134 0.93
135 0.93
136 0.91
137 0.89
138 0.83
139 0.79
140 0.69
141 0.6
142 0.53
143 0.41
144 0.32
145 0.25
146 0.2
147 0.15
148 0.16
149 0.14
150 0.12
151 0.18
152 0.28
153 0.3
154 0.37
155 0.41
156 0.48
157 0.55