Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4RQI5

Protein Details
Accession F4RQI5    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
53-74RLIRSVKKHLERPKPPKPNSRABasic
NLS Segment(s)
PositionSequence
41-78KPKYKSPSTIKSRLIRSVKKHLERPKPPKPNSRAAKKA
Subcellular Location(s) nucl 15.5, mito 10, cyto_nucl 10
Family & Domain DBs
KEGG mlr:MELLADRAFT_56377  -  
Amino Acid Sequences MPKDNPPSRIKSNRLSSIIQHLEKPTSILTRDLSSKAVLPKPKYKSPSTIKSRLIRSVKKHLERPKPPKPNSRAAKKAELTKQYGLPENSKFLFLKKGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.63
3 0.56
4 0.57
5 0.58
6 0.5
7 0.44
8 0.38
9 0.35
10 0.33
11 0.31
12 0.23
13 0.19
14 0.19
15 0.18
16 0.17
17 0.18
18 0.2
19 0.2
20 0.19
21 0.17
22 0.19
23 0.21
24 0.24
25 0.28
26 0.3
27 0.37
28 0.41
29 0.47
30 0.49
31 0.46
32 0.5
33 0.52
34 0.58
35 0.57
36 0.59
37 0.59
38 0.6
39 0.61
40 0.6
41 0.6
42 0.56
43 0.54
44 0.57
45 0.6
46 0.6
47 0.65
48 0.67
49 0.7
50 0.75
51 0.78
52 0.78
53 0.8
54 0.81
55 0.83
56 0.8
57 0.8
58 0.79
59 0.79
60 0.77
61 0.72
62 0.75
63 0.69
64 0.71
65 0.69
66 0.66
67 0.61
68 0.56
69 0.55
70 0.49
71 0.52
72 0.46
73 0.43
74 0.39
75 0.39
76 0.37
77 0.36
78 0.33
79 0.28