Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S2JPI0

Protein Details
Accession S2JPI0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
69-93PLKRSLRLSRRKLLKRHGSNKHTEQBasic
NLS Segment(s)
PositionSequence
74-84LRLSRRKLLKR
Subcellular Location(s) extr 21, E.R. 3, golg 2
Family & Domain DBs
Amino Acid Sequences MRLNILSLFSIAAIAMSASSVYAVDVPGAADATANMAAGIPGCVTVDQAGAIVPCVAGAVVPSAESALPLKRSLRLSRRKLLKRHGSNKHTEQEVADKDSAAEEETDVYSSTFDDSDLYASTADAAFANSANVDEEGEANTADADSSAEEAELDPLTVNEAGVYSAAEDDATTAEGAEVDLASVINDTAAELTSFEDDQDQDIDQDLDVDEGEEEDEEEPDEEEEDEDEEEEDEDEEDEDEEEEDEYDDDEYDDGYRDGYAAAVAEGAQEPDETGDEYASSPDEVI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.04
4 0.04
5 0.03
6 0.04
7 0.04
8 0.04
9 0.05
10 0.05
11 0.05
12 0.05
13 0.06
14 0.06
15 0.06
16 0.06
17 0.05
18 0.05
19 0.07
20 0.07
21 0.07
22 0.06
23 0.06
24 0.06
25 0.06
26 0.07
27 0.04
28 0.04
29 0.05
30 0.05
31 0.05
32 0.06
33 0.06
34 0.06
35 0.06
36 0.06
37 0.06
38 0.06
39 0.06
40 0.05
41 0.04
42 0.04
43 0.04
44 0.03
45 0.03
46 0.04
47 0.04
48 0.05
49 0.05
50 0.05
51 0.05
52 0.06
53 0.08
54 0.09
55 0.11
56 0.13
57 0.14
58 0.18
59 0.24
60 0.32
61 0.4
62 0.48
63 0.54
64 0.62
65 0.71
66 0.75
67 0.78
68 0.8
69 0.8
70 0.8
71 0.83
72 0.84
73 0.81
74 0.81
75 0.79
76 0.74
77 0.65
78 0.55
79 0.46
80 0.43
81 0.39
82 0.34
83 0.27
84 0.22
85 0.2
86 0.2
87 0.18
88 0.12
89 0.09
90 0.05
91 0.06
92 0.06
93 0.07
94 0.07
95 0.07
96 0.06
97 0.06
98 0.07
99 0.06
100 0.05
101 0.06
102 0.06
103 0.06
104 0.07
105 0.07
106 0.06
107 0.06
108 0.06
109 0.06
110 0.06
111 0.05
112 0.05
113 0.04
114 0.04
115 0.04
116 0.04
117 0.04
118 0.04
119 0.04
120 0.04
121 0.04
122 0.04
123 0.05
124 0.05
125 0.05
126 0.05
127 0.04
128 0.04
129 0.04
130 0.04
131 0.03
132 0.03
133 0.03
134 0.03
135 0.03
136 0.04
137 0.04
138 0.05
139 0.04
140 0.04
141 0.04
142 0.04
143 0.05
144 0.05
145 0.05
146 0.04
147 0.04
148 0.04
149 0.04
150 0.04
151 0.03
152 0.03
153 0.03
154 0.03
155 0.03
156 0.03
157 0.03
158 0.04
159 0.04
160 0.04
161 0.04
162 0.04
163 0.04
164 0.04
165 0.03
166 0.03
167 0.03
168 0.03
169 0.03
170 0.03
171 0.03
172 0.03
173 0.03
174 0.03
175 0.03
176 0.03
177 0.03
178 0.04
179 0.05
180 0.06
181 0.06
182 0.06
183 0.07
184 0.07
185 0.08
186 0.09
187 0.08
188 0.07
189 0.08
190 0.09
191 0.07
192 0.08
193 0.07
194 0.06
195 0.05
196 0.05
197 0.04
198 0.04
199 0.05
200 0.04
201 0.05
202 0.05
203 0.05
204 0.05
205 0.06
206 0.06
207 0.06
208 0.07
209 0.07
210 0.07
211 0.07
212 0.07
213 0.07
214 0.07
215 0.07
216 0.07
217 0.07
218 0.07
219 0.07
220 0.06
221 0.07
222 0.07
223 0.07
224 0.07
225 0.07
226 0.07
227 0.07
228 0.07
229 0.07
230 0.07
231 0.07
232 0.07
233 0.07
234 0.07
235 0.07
236 0.07
237 0.06
238 0.07
239 0.07
240 0.08
241 0.07
242 0.07
243 0.07
244 0.07
245 0.07
246 0.07
247 0.06
248 0.05
249 0.05
250 0.05
251 0.05
252 0.06
253 0.07
254 0.07
255 0.07
256 0.07
257 0.07
258 0.08
259 0.09
260 0.09
261 0.09
262 0.09
263 0.09
264 0.1
265 0.11
266 0.11