Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S2J2V8

Protein Details
Accession S2J2V8   
Localization Confidence Low
Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
364-383DTILQKNIKKRAKMHRYGAAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, nucl 3.5, cyto_nucl 3.5, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR005794  Fmt  
IPR005793  Formyl_trans_C  
IPR002376  Formyl_transf_N  
IPR036477  Formyl_transf_N_sf  
IPR011034  Formyl_transferase-like_C_sf  
IPR041711  Met-tRNA-FMT_N  
Gene Ontology GO:0004479  F:methionyl-tRNA formyltransferase activity  
Pfam View protein in Pfam  
PF02911  Formyl_trans_C  
PF00551  Formyl_trans_N  
CDD cd08646  FMT_core_Met-tRNA-FMT_N  
Amino Acid Sequences MLKHFTQHIWKPNRIRIAQFHSASSANDKLRVLFFGTDNFAKSHLQGLIKEKDRNDSCIESIDVVCPPDRRTGRKLEKLTPSETKGVAESSNLNIYHTPPQAKTLQDWHVPSDIAYDVGVVVSFGYFIPSHIISSLKHGAVNVHPSLLPKYRGAAPIQHAIMYGDAETGVTIQELDDREFDAGRILAQEHVSLGQAPPIYSLLKDKLSAIGSHLLVDTIRNLRQRKQDAATQDISKVTKAPKIKKEWSELDFVNMSAWQAEQLHRAIGEQYPLRAVFEKKNKPFAVQLLHLEIPNQPSAVLKGCAPGSFAWDEPSQSLHVLFGDGSVVACTRLKMQNKGAVSASDFVNGYGPQGQFGVSLDLDDTILQKNIKKRAKMHRYGAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.69
3 0.68
4 0.68
5 0.69
6 0.62
7 0.56
8 0.49
9 0.47
10 0.41
11 0.38
12 0.36
13 0.28
14 0.3
15 0.29
16 0.28
17 0.29
18 0.29
19 0.26
20 0.22
21 0.21
22 0.21
23 0.25
24 0.24
25 0.24
26 0.23
27 0.22
28 0.2
29 0.2
30 0.21
31 0.21
32 0.22
33 0.25
34 0.31
35 0.38
36 0.44
37 0.48
38 0.45
39 0.5
40 0.5
41 0.5
42 0.48
43 0.43
44 0.38
45 0.36
46 0.36
47 0.28
48 0.26
49 0.23
50 0.19
51 0.17
52 0.19
53 0.17
54 0.18
55 0.25
56 0.3
57 0.34
58 0.38
59 0.48
60 0.56
61 0.63
62 0.68
63 0.67
64 0.72
65 0.7
66 0.71
67 0.66
68 0.6
69 0.54
70 0.48
71 0.41
72 0.32
73 0.29
74 0.23
75 0.18
76 0.16
77 0.15
78 0.19
79 0.18
80 0.18
81 0.17
82 0.19
83 0.25
84 0.26
85 0.27
86 0.23
87 0.27
88 0.3
89 0.3
90 0.3
91 0.3
92 0.32
93 0.34
94 0.35
95 0.33
96 0.31
97 0.3
98 0.27
99 0.22
100 0.17
101 0.12
102 0.1
103 0.08
104 0.06
105 0.06
106 0.06
107 0.04
108 0.03
109 0.03
110 0.03
111 0.03
112 0.05
113 0.05
114 0.05
115 0.08
116 0.09
117 0.09
118 0.09
119 0.11
120 0.09
121 0.15
122 0.19
123 0.17
124 0.17
125 0.17
126 0.18
127 0.19
128 0.24
129 0.18
130 0.15
131 0.15
132 0.16
133 0.19
134 0.21
135 0.21
136 0.16
137 0.18
138 0.21
139 0.23
140 0.23
141 0.24
142 0.24
143 0.27
144 0.27
145 0.24
146 0.21
147 0.19
148 0.17
149 0.13
150 0.1
151 0.05
152 0.04
153 0.04
154 0.04
155 0.04
156 0.03
157 0.03
158 0.03
159 0.03
160 0.05
161 0.06
162 0.07
163 0.08
164 0.08
165 0.09
166 0.09
167 0.09
168 0.07
169 0.06
170 0.05
171 0.06
172 0.05
173 0.06
174 0.06
175 0.06
176 0.06
177 0.06
178 0.06
179 0.06
180 0.06
181 0.07
182 0.07
183 0.07
184 0.07
185 0.08
186 0.08
187 0.08
188 0.1
189 0.11
190 0.11
191 0.12
192 0.11
193 0.13
194 0.14
195 0.14
196 0.13
197 0.15
198 0.14
199 0.14
200 0.13
201 0.1
202 0.09
203 0.09
204 0.1
205 0.09
206 0.12
207 0.18
208 0.2
209 0.25
210 0.34
211 0.38
212 0.41
213 0.41
214 0.42
215 0.4
216 0.44
217 0.42
218 0.34
219 0.31
220 0.29
221 0.26
222 0.22
223 0.21
224 0.18
225 0.19
226 0.26
227 0.33
228 0.39
229 0.47
230 0.54
231 0.57
232 0.62
233 0.64
234 0.59
235 0.56
236 0.47
237 0.42
238 0.35
239 0.29
240 0.22
241 0.16
242 0.13
243 0.09
244 0.08
245 0.06
246 0.07
247 0.08
248 0.1
249 0.11
250 0.11
251 0.11
252 0.12
253 0.12
254 0.12
255 0.15
256 0.13
257 0.13
258 0.15
259 0.15
260 0.16
261 0.18
262 0.2
263 0.24
264 0.33
265 0.43
266 0.45
267 0.55
268 0.54
269 0.53
270 0.54
271 0.51
272 0.47
273 0.4
274 0.38
275 0.34
276 0.34
277 0.31
278 0.29
279 0.25
280 0.22
281 0.19
282 0.16
283 0.11
284 0.11
285 0.13
286 0.15
287 0.14
288 0.12
289 0.15
290 0.15
291 0.16
292 0.16
293 0.15
294 0.16
295 0.17
296 0.17
297 0.17
298 0.17
299 0.18
300 0.17
301 0.19
302 0.16
303 0.14
304 0.14
305 0.11
306 0.11
307 0.1
308 0.09
309 0.08
310 0.07
311 0.06
312 0.06
313 0.06
314 0.06
315 0.07
316 0.08
317 0.08
318 0.13
319 0.21
320 0.26
321 0.32
322 0.39
323 0.44
324 0.45
325 0.48
326 0.44
327 0.38
328 0.35
329 0.31
330 0.25
331 0.21
332 0.19
333 0.17
334 0.17
335 0.16
336 0.15
337 0.18
338 0.17
339 0.15
340 0.16
341 0.16
342 0.14
343 0.15
344 0.16
345 0.11
346 0.11
347 0.11
348 0.11
349 0.11
350 0.11
351 0.11
352 0.1
353 0.13
354 0.15
355 0.2
356 0.27
357 0.37
358 0.44
359 0.5
360 0.57
361 0.66
362 0.75
363 0.8