Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4S6H4

Protein Details
Accession F4S6H4   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
129-150PLTSSQKIRRPIPRKRHLLQVAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, cyto_nucl 12.5, mito 3
Family & Domain DBs
KEGG mlr:MELLADRAFT_68351  -  
Amino Acid Sequences MTSPNKDITMSQPSSMSTLITEAILKEPVTQDPRGITPATNPPSTTSMAEAFNNALAQQASQFATIIKTLEKKIEDLSVPGSNAKINHPPPVEKTQASSMASSSCAYQGLTPSTSKSNHSLPRKGTTVPLTSSQKIRRPIPRKRHLLQVASSVFPVDFQQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.28
3 0.22
4 0.13
5 0.12
6 0.11
7 0.1
8 0.1
9 0.09
10 0.1
11 0.11
12 0.11
13 0.12
14 0.13
15 0.18
16 0.22
17 0.22
18 0.21
19 0.22
20 0.23
21 0.24
22 0.23
23 0.18
24 0.18
25 0.27
26 0.29
27 0.28
28 0.27
29 0.27
30 0.29
31 0.31
32 0.27
33 0.2
34 0.18
35 0.19
36 0.18
37 0.16
38 0.14
39 0.12
40 0.12
41 0.09
42 0.08
43 0.06
44 0.06
45 0.06
46 0.07
47 0.07
48 0.07
49 0.08
50 0.07
51 0.08
52 0.08
53 0.08
54 0.08
55 0.09
56 0.1
57 0.13
58 0.14
59 0.14
60 0.14
61 0.16
62 0.15
63 0.13
64 0.15
65 0.13
66 0.13
67 0.12
68 0.12
69 0.1
70 0.11
71 0.12
72 0.16
73 0.16
74 0.22
75 0.23
76 0.24
77 0.27
78 0.32
79 0.33
80 0.27
81 0.28
82 0.26
83 0.28
84 0.28
85 0.24
86 0.19
87 0.16
88 0.17
89 0.15
90 0.12
91 0.09
92 0.08
93 0.08
94 0.08
95 0.1
96 0.11
97 0.12
98 0.13
99 0.14
100 0.17
101 0.19
102 0.2
103 0.22
104 0.27
105 0.34
106 0.41
107 0.46
108 0.47
109 0.51
110 0.51
111 0.49
112 0.46
113 0.43
114 0.39
115 0.35
116 0.39
117 0.39
118 0.39
119 0.46
120 0.48
121 0.5
122 0.53
123 0.58
124 0.61
125 0.65
126 0.73
127 0.76
128 0.79
129 0.82
130 0.78
131 0.82
132 0.79
133 0.76
134 0.68
135 0.66
136 0.59
137 0.51
138 0.47
139 0.37
140 0.29