Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S2KFW8

Protein Details
Accession S2KFW8    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
64-86IRELYPCKKSKKVRRGRGICLTLHydrophilic
NLS Segment(s)
PositionSequence
74-77KKVR
Subcellular Location(s) nucl 22.5, cyto_nucl 16, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003173  PC4_C  
IPR009044  ssDNA-bd_transcriptional_reg  
Gene Ontology GO:0003677  F:DNA binding  
GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF02229  PC4  
Amino Acid Sequences MKKRSYVKTNAIIYDSDQEVNEVEETDITPGDEQSCQPKKSFHISRKKTLSLGQFQNGDAFIDIRELYPCKKSKKVRRGRGICLTLTQWRKIVGLMPEIEQSIREILSKNEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.32
3 0.24
4 0.19
5 0.17
6 0.15
7 0.16
8 0.14
9 0.1
10 0.08
11 0.08
12 0.08
13 0.08
14 0.08
15 0.07
16 0.07
17 0.06
18 0.08
19 0.08
20 0.09
21 0.18
22 0.24
23 0.25
24 0.26
25 0.28
26 0.3
27 0.4
28 0.48
29 0.47
30 0.52
31 0.57
32 0.64
33 0.68
34 0.66
35 0.58
36 0.54
37 0.5
38 0.47
39 0.44
40 0.38
41 0.33
42 0.31
43 0.3
44 0.24
45 0.19
46 0.11
47 0.09
48 0.06
49 0.06
50 0.06
51 0.06
52 0.07
53 0.08
54 0.09
55 0.16
56 0.21
57 0.25
58 0.34
59 0.44
60 0.53
61 0.63
62 0.72
63 0.77
64 0.83
65 0.85
66 0.85
67 0.85
68 0.78
69 0.67
70 0.59
71 0.52
72 0.49
73 0.45
74 0.39
75 0.31
76 0.28
77 0.27
78 0.25
79 0.27
80 0.22
81 0.23
82 0.22
83 0.22
84 0.22
85 0.23
86 0.22
87 0.18
88 0.16
89 0.13
90 0.12
91 0.12
92 0.12