Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S2J370

Protein Details
Accession S2J370    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
4-33DLPTKDNKKTAPKDSKKRKISRRETYSSYIHydrophilic
NLS Segment(s)
PositionSequence
11-25KKTAPKDSKKRKISR
Subcellular Location(s) nucl 21.5, cyto_nucl 13, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR007125  Histone_H2A/H2B/H3  
IPR000558  Histone_H2B  
Gene Ontology GO:0000786  C:nucleosome  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046982  F:protein heterodimerization activity  
GO:0030527  F:structural constituent of chromatin  
Pfam View protein in Pfam  
PF00125  Histone  
PROSITE View protein in PROSITE  
PS00357  HISTONE_H2B  
Amino Acid Sequences MAADLPTKDNKKTAPKDSKKRKISRRETYSSYIYKVLKQVHPDTGISNKAMSILNSFVNDIFERIASEASKLAAYNKRSTISSREIQTAVRLILPGELAKHAVSEGTKAVTKYTSSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.69
3 0.79
4 0.86
5 0.9
6 0.9
7 0.92
8 0.91
9 0.91
10 0.91
11 0.91
12 0.89
13 0.85
14 0.8
15 0.75
16 0.72
17 0.63
18 0.55
19 0.49
20 0.41
21 0.36
22 0.35
23 0.36
24 0.32
25 0.35
26 0.36
27 0.34
28 0.35
29 0.33
30 0.3
31 0.28
32 0.26
33 0.21
34 0.18
35 0.14
36 0.13
37 0.13
38 0.12
39 0.1
40 0.09
41 0.1
42 0.1
43 0.1
44 0.09
45 0.09
46 0.09
47 0.08
48 0.07
49 0.06
50 0.06
51 0.06
52 0.07
53 0.06
54 0.06
55 0.07
56 0.07
57 0.07
58 0.07
59 0.11
60 0.16
61 0.19
62 0.22
63 0.24
64 0.25
65 0.26
66 0.29
67 0.3
68 0.3
69 0.33
70 0.31
71 0.32
72 0.31
73 0.31
74 0.3
75 0.27
76 0.21
77 0.17
78 0.14
79 0.11
80 0.11
81 0.12
82 0.1
83 0.09
84 0.09
85 0.1
86 0.1
87 0.1
88 0.09
89 0.1
90 0.1
91 0.11
92 0.11
93 0.13
94 0.16
95 0.16
96 0.18
97 0.18