Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S2J0K7

Protein Details
Accession S2J0K7   
Localization Confidence Medium
Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
18-40TTTSSSTSNRRGRKRKSMDDELDHydrophilic
NLS Segment(s)
PositionSequence
30-32RKR
Subcellular Location(s) nucl 17.5, cyto_nucl 11.5, mito 6
Family & Domain DBs
Amino Acid Sequences MLLRSGYNYQYPAVTTTTTTSSSTSNRRGRKRKSMDDELDERSPKKHQQQPSSSSHPALPVATPSPSNPPVLSSSPAPVSNEKGPRRVRFSNDVVTYLFEVDNEPCRAADHSYVDFLPWW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.15
3 0.16
4 0.17
5 0.18
6 0.18
7 0.17
8 0.19
9 0.23
10 0.29
11 0.36
12 0.42
13 0.48
14 0.58
15 0.67
16 0.73
17 0.79
18 0.81
19 0.82
20 0.83
21 0.85
22 0.8
23 0.76
24 0.72
25 0.65
26 0.6
27 0.51
28 0.43
29 0.34
30 0.32
31 0.32
32 0.37
33 0.39
34 0.43
35 0.51
36 0.58
37 0.63
38 0.66
39 0.67
40 0.59
41 0.53
42 0.45
43 0.37
44 0.29
45 0.23
46 0.16
47 0.1
48 0.1
49 0.09
50 0.09
51 0.09
52 0.14
53 0.15
54 0.15
55 0.14
56 0.15
57 0.18
58 0.19
59 0.2
60 0.16
61 0.16
62 0.17
63 0.19
64 0.19
65 0.17
66 0.2
67 0.24
68 0.32
69 0.32
70 0.39
71 0.45
72 0.48
73 0.54
74 0.55
75 0.55
76 0.53
77 0.56
78 0.57
79 0.51
80 0.48
81 0.41
82 0.37
83 0.32
84 0.26
85 0.21
86 0.12
87 0.12
88 0.12
89 0.18
90 0.17
91 0.17
92 0.16
93 0.18
94 0.2
95 0.21
96 0.24
97 0.23
98 0.23
99 0.26
100 0.26