Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q5A853

Protein Details
Accession Q5A853   
Localization Confidence Medium
Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
110-131NTMWRKRKLESPSNSNKKKRLSHydrophilic
NLS Segment(s)
PositionSequence
124-129SNKKKR
Subcellular Location(s) nucl 22, mito_nucl 13.666, cyto_nucl 13.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR019324  MPP6  
KEGG cal:CAALFM_CR00810WA  -  
Pfam View protein in Pfam  
PF10175  MPP6  
Amino Acid Sequences MSTGLSNRVMNMKFMQKAEDSKLGKQKLEEQKKIHDLSEWVLPDSAKLLKLAAMKPKIDRVGFGTIMTNGNYNYSSTTKRSWGSNVSFEEIKDDDSNNVEDNDDEPLDLNTMWRKRKLESPSNSNKKKRLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.35
3 0.31
4 0.34
5 0.37
6 0.41
7 0.37
8 0.4
9 0.48
10 0.48
11 0.46
12 0.44
13 0.48
14 0.5
15 0.58
16 0.58
17 0.53
18 0.58
19 0.64
20 0.64
21 0.54
22 0.46
23 0.37
24 0.31
25 0.34
26 0.26
27 0.2
28 0.18
29 0.18
30 0.15
31 0.16
32 0.15
33 0.09
34 0.09
35 0.08
36 0.11
37 0.14
38 0.17
39 0.22
40 0.24
41 0.25
42 0.26
43 0.3
44 0.31
45 0.27
46 0.25
47 0.22
48 0.23
49 0.22
50 0.21
51 0.17
52 0.15
53 0.16
54 0.15
55 0.12
56 0.07
57 0.08
58 0.08
59 0.08
60 0.09
61 0.1
62 0.13
63 0.15
64 0.17
65 0.19
66 0.2
67 0.22
68 0.23
69 0.27
70 0.28
71 0.31
72 0.31
73 0.31
74 0.3
75 0.28
76 0.29
77 0.22
78 0.21
79 0.16
80 0.15
81 0.13
82 0.15
83 0.16
84 0.14
85 0.14
86 0.12
87 0.11
88 0.11
89 0.13
90 0.11
91 0.1
92 0.09
93 0.09
94 0.1
95 0.1
96 0.11
97 0.16
98 0.23
99 0.28
100 0.33
101 0.35
102 0.38
103 0.46
104 0.53
105 0.56
106 0.59
107 0.64
108 0.69
109 0.78
110 0.84
111 0.85