Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S2J1X0

Protein Details
Accession S2J1X0   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
53-73LVPSDADKRTPRRRRKEVQATHydrophilic
NLS Segment(s)
PositionSequence
62-68TPRRRRK
Subcellular Location(s) nucl 11.5, cyto_nucl 10.333, cyto 8, cyto_mito 6.833, mito 4.5
Family & Domain DBs
Amino Acid Sequences IQVQEDAIPVKVAPRMIPRAAQEWFKGYLDQLLLELIKLTEPCTGPWAAGVVLVPSDADKRTPRRRRKEVQAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.24
3 0.26
4 0.29
5 0.3
6 0.32
7 0.33
8 0.33
9 0.28
10 0.25
11 0.26
12 0.23
13 0.21
14 0.17
15 0.17
16 0.14
17 0.13
18 0.1
19 0.08
20 0.07
21 0.06
22 0.06
23 0.04
24 0.04
25 0.04
26 0.05
27 0.08
28 0.08
29 0.09
30 0.11
31 0.12
32 0.11
33 0.11
34 0.11
35 0.08
36 0.08
37 0.08
38 0.05
39 0.05
40 0.05
41 0.05
42 0.05
43 0.07
44 0.07
45 0.11
46 0.17
47 0.27
48 0.38
49 0.49
50 0.59
51 0.68
52 0.78
53 0.85