Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4RDS8

Protein Details
Accession F4RDS8   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
17-43RITESDDKKFCRNKKKRVHESTDESGTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 13.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011009  Kinase-like_dom_sf  
IPR004166  MHCK_EF2_kinase  
Gene Ontology GO:0005524  F:ATP binding  
GO:0004674  F:protein serine/threonine kinase activity  
GO:0006468  P:protein phosphorylation  
KEGG mlr:MELLADRAFT_104163  -  
Pfam View protein in Pfam  
PF02816  Alpha_kinase  
Amino Acid Sequences MNKQCLYVKFDADEYLRITESDDKKFCRNKKKRVHESTDESGTDPSLQDKEENYIPKHKRLHSPSDRSDTHQDQEDDSNIAYRPDPDEIFETEHVDQTITPGCLLNTPMVELNTCIGELKLVVIESPLPIASVQRTPPQPKLWILGVAKAVVYHPQSPNSTLFNSDWMFVLGEEPHLGWLDIQGVPKEDTSKDENQVDEYDSIPFCASTSSFDSPNSHAQLRLFAEAQRIIGKFHQKRKGAYTPPKGFMTAVNFTIKKPYNLDHQIMHCLTHFRIDEYKGKSLLCILQASGRIITQVELIHSNSAIGDDNPGEDSLKIFLENHSCPPPCEFLGLHKLDVPYTD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.25
3 0.22
4 0.2
5 0.22
6 0.27
7 0.31
8 0.37
9 0.39
10 0.41
11 0.5
12 0.59
13 0.65
14 0.68
15 0.73
16 0.75
17 0.81
18 0.88
19 0.9
20 0.92
21 0.92
22 0.9
23 0.88
24 0.84
25 0.79
26 0.68
27 0.58
28 0.48
29 0.39
30 0.31
31 0.23
32 0.19
33 0.14
34 0.14
35 0.15
36 0.15
37 0.19
38 0.24
39 0.29
40 0.3
41 0.39
42 0.42
43 0.48
44 0.55
45 0.57
46 0.61
47 0.63
48 0.7
49 0.7
50 0.76
51 0.75
52 0.76
53 0.72
54 0.67
55 0.68
56 0.61
57 0.53
58 0.51
59 0.44
60 0.38
61 0.39
62 0.34
63 0.27
64 0.23
65 0.22
66 0.16
67 0.16
68 0.14
69 0.12
70 0.13
71 0.15
72 0.15
73 0.15
74 0.17
75 0.18
76 0.21
77 0.21
78 0.22
79 0.2
80 0.2
81 0.19
82 0.16
83 0.14
84 0.12
85 0.15
86 0.12
87 0.11
88 0.11
89 0.11
90 0.12
91 0.13
92 0.12
93 0.09
94 0.1
95 0.1
96 0.1
97 0.1
98 0.09
99 0.09
100 0.08
101 0.08
102 0.07
103 0.06
104 0.05
105 0.05
106 0.05
107 0.05
108 0.04
109 0.04
110 0.04
111 0.05
112 0.05
113 0.05
114 0.05
115 0.05
116 0.05
117 0.06
118 0.07
119 0.1
120 0.11
121 0.16
122 0.21
123 0.25
124 0.29
125 0.32
126 0.33
127 0.32
128 0.34
129 0.29
130 0.31
131 0.27
132 0.26
133 0.23
134 0.2
135 0.18
136 0.15
137 0.14
138 0.11
139 0.13
140 0.14
141 0.14
142 0.17
143 0.18
144 0.2
145 0.22
146 0.21
147 0.2
148 0.18
149 0.17
150 0.17
151 0.17
152 0.15
153 0.13
154 0.12
155 0.11
156 0.09
157 0.09
158 0.06
159 0.06
160 0.05
161 0.05
162 0.05
163 0.05
164 0.05
165 0.04
166 0.04
167 0.06
168 0.07
169 0.08
170 0.08
171 0.09
172 0.1
173 0.11
174 0.12
175 0.1
176 0.12
177 0.17
178 0.2
179 0.22
180 0.23
181 0.23
182 0.22
183 0.23
184 0.21
185 0.17
186 0.14
187 0.13
188 0.11
189 0.11
190 0.1
191 0.09
192 0.07
193 0.07
194 0.07
195 0.08
196 0.13
197 0.14
198 0.15
199 0.16
200 0.19
201 0.21
202 0.26
203 0.26
204 0.22
205 0.22
206 0.21
207 0.25
208 0.24
209 0.23
210 0.19
211 0.17
212 0.19
213 0.18
214 0.19
215 0.18
216 0.16
217 0.16
218 0.19
219 0.28
220 0.32
221 0.41
222 0.49
223 0.49
224 0.52
225 0.59
226 0.64
227 0.64
228 0.67
229 0.69
230 0.67
231 0.67
232 0.65
233 0.58
234 0.49
235 0.42
236 0.38
237 0.3
238 0.26
239 0.27
240 0.26
241 0.26
242 0.34
243 0.32
244 0.28
245 0.29
246 0.29
247 0.33
248 0.39
249 0.41
250 0.37
251 0.38
252 0.42
253 0.4
254 0.38
255 0.29
256 0.26
257 0.24
258 0.25
259 0.24
260 0.19
261 0.23
262 0.27
263 0.33
264 0.36
265 0.4
266 0.36
267 0.35
268 0.33
269 0.32
270 0.31
271 0.26
272 0.22
273 0.18
274 0.19
275 0.22
276 0.23
277 0.21
278 0.17
279 0.15
280 0.14
281 0.14
282 0.13
283 0.11
284 0.12
285 0.13
286 0.14
287 0.15
288 0.14
289 0.14
290 0.12
291 0.12
292 0.11
293 0.09
294 0.11
295 0.1
296 0.11
297 0.12
298 0.12
299 0.12
300 0.11
301 0.12
302 0.11
303 0.11
304 0.11
305 0.11
306 0.14
307 0.2
308 0.22
309 0.27
310 0.33
311 0.33
312 0.34
313 0.37
314 0.39
315 0.33
316 0.34
317 0.3
318 0.29
319 0.38
320 0.39
321 0.36
322 0.35
323 0.35