Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S2J3J3

Protein Details
Accession S2J3J3    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MPAEKKKKSVKVTKLYRRTRFKNSLEHydrophilic
NLS Segment(s)
PositionSequence
6-8KKK
Subcellular Location(s) nucl 22.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
Gene Ontology GO:0046982  F:protein heterodimerization activity  
Amino Acid Sequences MPAEKKKKSVKVTKLYRRTRFKNSLESSLDGKKITGDTDVLMYMNFLMFLDRLAKASEQAAEERGSSRVREPDVDKYLQVSATDMYKVLYFNKH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.9
3 0.89
4 0.89
5 0.86
6 0.85
7 0.84
8 0.78
9 0.78
10 0.72
11 0.7
12 0.63
13 0.59
14 0.52
15 0.46
16 0.42
17 0.32
18 0.27
19 0.2
20 0.17
21 0.15
22 0.12
23 0.09
24 0.08
25 0.09
26 0.09
27 0.08
28 0.07
29 0.06
30 0.05
31 0.04
32 0.04
33 0.03
34 0.03
35 0.03
36 0.04
37 0.05
38 0.06
39 0.06
40 0.07
41 0.08
42 0.08
43 0.09
44 0.1
45 0.1
46 0.1
47 0.11
48 0.11
49 0.12
50 0.12
51 0.14
52 0.13
53 0.13
54 0.16
55 0.19
56 0.2
57 0.24
58 0.27
59 0.33
60 0.37
61 0.38
62 0.35
63 0.32
64 0.32
65 0.29
66 0.25
67 0.18
68 0.14
69 0.14
70 0.14
71 0.12
72 0.12
73 0.12
74 0.13