Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4SDE5

Protein Details
Accession F4SDE5   
Localization Confidence Medium
Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
28-48VNPKRGVRRNVQRRPLKRAPMHydrophilic
NLS Segment(s)
PositionSequence
16-45PRRQVARKRVYVVNPKRGVRRNVQRRPLKR
Subcellular Location(s) mito 20, nucl 6
Family & Domain DBs
KEGG mlr:MELLADRAFT_114424  -  
Amino Acid Sequences MPVRLRIKTAIINVRPRRQVARKRVYVVNPKRGVRRNVQRRPLKRAPMPSVTDDPIFWNKIDTLPQSLCKYLKPNCDISSITCFNLRRLIWHFEPDKAISECLRSENSLQLSIGKIGDQLDSKNIYVNG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.66
3 0.64
4 0.66
5 0.66
6 0.69
7 0.7
8 0.72
9 0.71
10 0.72
11 0.75
12 0.75
13 0.76
14 0.75
15 0.74
16 0.7
17 0.68
18 0.71
19 0.71
20 0.68
21 0.67
22 0.68
23 0.69
24 0.72
25 0.78
26 0.79
27 0.78
28 0.82
29 0.81
30 0.78
31 0.73
32 0.72
33 0.67
34 0.64
35 0.61
36 0.55
37 0.5
38 0.44
39 0.38
40 0.3
41 0.27
42 0.23
43 0.21
44 0.17
45 0.14
46 0.13
47 0.13
48 0.15
49 0.13
50 0.14
51 0.14
52 0.17
53 0.18
54 0.19
55 0.19
56 0.18
57 0.23
58 0.24
59 0.3
60 0.3
61 0.33
62 0.33
63 0.36
64 0.35
65 0.32
66 0.34
67 0.29
68 0.26
69 0.26
70 0.25
71 0.23
72 0.28
73 0.25
74 0.23
75 0.26
76 0.32
77 0.29
78 0.36
79 0.36
80 0.32
81 0.35
82 0.32
83 0.32
84 0.27
85 0.27
86 0.21
87 0.22
88 0.2
89 0.2
90 0.21
91 0.18
92 0.18
93 0.23
94 0.24
95 0.23
96 0.22
97 0.21
98 0.21
99 0.21
100 0.19
101 0.14
102 0.12
103 0.12
104 0.14
105 0.14
106 0.14
107 0.17
108 0.2
109 0.2