Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S2JK48

Protein Details
Accession S2JK48    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
20-39DNKDDSKKPFNYKSKRQQGGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 9, cyto 8, cyto_nucl 6.833, mito_nucl 6.833, cyto_pero 6.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR036397  RNaseH_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
Amino Acid Sequences MIIHHDTWTIHTARGYLTMDNKDDSKKPFNYKSKRQQGGGSLMVWGYMTALGPGYACRMLEKSMNSDLYQHVLGTTYFDLLHYYGLQHEDVIFQQDGATCQTSDPTYNWMDKKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.21
3 0.19
4 0.23
5 0.25
6 0.26
7 0.27
8 0.29
9 0.28
10 0.3
11 0.33
12 0.36
13 0.38
14 0.44
15 0.52
16 0.61
17 0.67
18 0.73
19 0.78
20 0.81
21 0.8
22 0.74
23 0.68
24 0.63
25 0.59
26 0.5
27 0.39
28 0.29
29 0.24
30 0.21
31 0.17
32 0.12
33 0.06
34 0.04
35 0.04
36 0.03
37 0.03
38 0.03
39 0.03
40 0.04
41 0.05
42 0.05
43 0.05
44 0.06
45 0.06
46 0.08
47 0.1
48 0.11
49 0.13
50 0.16
51 0.18
52 0.17
53 0.18
54 0.17
55 0.17
56 0.16
57 0.12
58 0.09
59 0.09
60 0.08
61 0.09
62 0.09
63 0.08
64 0.07
65 0.08
66 0.09
67 0.08
68 0.09
69 0.07
70 0.07
71 0.08
72 0.1
73 0.1
74 0.09
75 0.09
76 0.09
77 0.09
78 0.13
79 0.12
80 0.1
81 0.11
82 0.12
83 0.13
84 0.15
85 0.16
86 0.12
87 0.12
88 0.15
89 0.16
90 0.17
91 0.17
92 0.19
93 0.21
94 0.27