Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S2IYI5

Protein Details
Accession S2IYI5    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
40-64FRLKTDTKIRWNAKRRNWRHTKLNIHydrophilic
NLS Segment(s)
PositionSequence
25-58KLGKAKKQNRPLPHWFRLKTDTKIRWNAKRRNWR
Subcellular Location(s) nucl 19.5, mito_nucl 13, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000077  Ribosomal_L39  
IPR023626  Ribosomal_L39e_dom_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00832  Ribosomal_L39  
Amino Acid Sequences MDAWMKMMISMMDDPSQKSFITKVKLGKAKKQNRPLPHWFRLKTDTKIRWNAKRRNWRHTKLNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.18
3 0.19
4 0.16
5 0.16
6 0.18
7 0.19
8 0.23
9 0.26
10 0.29
11 0.35
12 0.43
13 0.45
14 0.5
15 0.56
16 0.61
17 0.66
18 0.71
19 0.7
20 0.7
21 0.75
22 0.76
23 0.74
24 0.72
25 0.72
26 0.64
27 0.61
28 0.62
29 0.6
30 0.56
31 0.57
32 0.57
33 0.57
34 0.65
35 0.69
36 0.72
37 0.76
38 0.79
39 0.8
40 0.83
41 0.83
42 0.84
43 0.87
44 0.85