Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S2J1X9

Protein Details
Accession S2J1X9    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
50-71KSTPSKITKKVVKKKVPTVKAMHydrophilic
NLS Segment(s)
PositionSequence
58-65KKVVKKKV
Subcellular Location(s) mito 17, nucl 9.5, cyto_nucl 5.5
Family & Domain DBs
Amino Acid Sequences MSSNRRTRTRNNEQDVAQSAASTSATTAGSSGSSSTSTATTSTVSNAATKSTPSKITKKVVKKKVPTVKAMSSSAKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.62
3 0.54
4 0.42
5 0.31
6 0.24
7 0.19
8 0.17
9 0.12
10 0.08
11 0.07
12 0.07
13 0.07
14 0.07
15 0.06
16 0.06
17 0.06
18 0.07
19 0.05
20 0.06
21 0.06
22 0.07
23 0.07
24 0.07
25 0.07
26 0.07
27 0.07
28 0.07
29 0.08
30 0.08
31 0.08
32 0.09
33 0.09
34 0.1
35 0.09
36 0.1
37 0.13
38 0.15
39 0.21
40 0.25
41 0.32
42 0.38
43 0.46
44 0.54
45 0.62
46 0.69
47 0.73
48 0.78
49 0.8
50 0.84
51 0.85
52 0.83
53 0.79
54 0.76
55 0.73
56 0.68
57 0.65