Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S2JZP3

Protein Details
Accession S2JZP3    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
51-79VVQAMKRQERLRRRKPKAKQMLNDKDKTTHydrophilic
NLS Segment(s)
PositionSequence
56-71KRQERLRRRKPKAKQM
Subcellular Location(s) nucl 23.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MQQKTQEEVQSKPLVISDEEGDDFEDDNIDLDMLEAEKEAAASSKPLAEDVVQAMKRQERLRRRKPKAKQMLNDKDKTTIRSRPDDTPSKKKAATKPSSCQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.23
3 0.23
4 0.17
5 0.15
6 0.15
7 0.15
8 0.14
9 0.13
10 0.13
11 0.1
12 0.09
13 0.07
14 0.07
15 0.06
16 0.06
17 0.05
18 0.04
19 0.05
20 0.04
21 0.04
22 0.04
23 0.04
24 0.04
25 0.04
26 0.04
27 0.04
28 0.04
29 0.05
30 0.05
31 0.06
32 0.06
33 0.06
34 0.07
35 0.07
36 0.07
37 0.08
38 0.13
39 0.12
40 0.12
41 0.14
42 0.15
43 0.19
44 0.23
45 0.3
46 0.35
47 0.46
48 0.56
49 0.66
50 0.75
51 0.81
52 0.86
53 0.89
54 0.9
55 0.89
56 0.86
57 0.86
58 0.87
59 0.85
60 0.8
61 0.71
62 0.66
63 0.59
64 0.55
65 0.5
66 0.46
67 0.44
68 0.47
69 0.5
70 0.5
71 0.56
72 0.61
73 0.64
74 0.67
75 0.67
76 0.66
77 0.66
78 0.67
79 0.68
80 0.69
81 0.71