Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S2J1C2

Protein Details
Accession S2J1C2    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
119-139FYWSTNKKPVPQKWQNSKVLEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, nucl 9, cyto_mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR005631  SDH  
IPR036714  SDH_sf  
IPR028882  SDHAF2  
Gene Ontology GO:0005759  C:mitochondrial matrix  
GO:0006121  P:mitochondrial electron transport, succinate to ubiquinone  
GO:0018293  P:protein-FAD linkage  
Pfam View protein in Pfam  
PF03937  Sdh5  
Amino Acid Sequences MSLSRARKVQLLARPLYRPISTLRPLFNKKSEDPFPDLAIRHSSEAALDSSYPNLPPIPRPNEETENKRRRLTYQSRKRGILETDLLLSTFAKVWLPQFSREQLEEYDKLLDEPDWDIFYWSTNKKPVPQKWQNSKVLEMITQHAKNEDKKVLRMPNLEESSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.48
3 0.48
4 0.41
5 0.35
6 0.32
7 0.35
8 0.35
9 0.37
10 0.4
11 0.44
12 0.5
13 0.55
14 0.57
15 0.55
16 0.53
17 0.57
18 0.57
19 0.53
20 0.53
21 0.49
22 0.45
23 0.43
24 0.39
25 0.33
26 0.31
27 0.27
28 0.23
29 0.21
30 0.18
31 0.14
32 0.15
33 0.13
34 0.1
35 0.09
36 0.08
37 0.09
38 0.1
39 0.1
40 0.09
41 0.1
42 0.1
43 0.14
44 0.22
45 0.26
46 0.28
47 0.32
48 0.36
49 0.42
50 0.46
51 0.49
52 0.52
53 0.55
54 0.57
55 0.55
56 0.51
57 0.47
58 0.52
59 0.55
60 0.56
61 0.58
62 0.64
63 0.66
64 0.67
65 0.65
66 0.59
67 0.49
68 0.42
69 0.32
70 0.23
71 0.19
72 0.17
73 0.16
74 0.12
75 0.11
76 0.07
77 0.06
78 0.05
79 0.05
80 0.05
81 0.06
82 0.12
83 0.14
84 0.17
85 0.19
86 0.21
87 0.24
88 0.24
89 0.25
90 0.21
91 0.24
92 0.22
93 0.21
94 0.2
95 0.17
96 0.16
97 0.15
98 0.13
99 0.09
100 0.1
101 0.1
102 0.1
103 0.1
104 0.11
105 0.1
106 0.12
107 0.17
108 0.18
109 0.2
110 0.25
111 0.27
112 0.34
113 0.44
114 0.5
115 0.55
116 0.63
117 0.7
118 0.76
119 0.83
120 0.83
121 0.77
122 0.71
123 0.64
124 0.56
125 0.47
126 0.38
127 0.33
128 0.33
129 0.31
130 0.29
131 0.3
132 0.33
133 0.35
134 0.4
135 0.44
136 0.4
137 0.44
138 0.52
139 0.56
140 0.58
141 0.58
142 0.57
143 0.58