Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S2JSI7

Protein Details
Accession S2JSI7   
Localization Confidence High
Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
3-98RSPSPPSTKRYSSRQRERDYRDLDNPRSRSRSPGASRRRRREDSYDRYESRGRRRDDSRDRYRRSRSSRSPPSRRDRRSPDTRDRGRPRNRSRSRSBasic
170-190GAKIHKPIKYRQYMNRRGGFNHydrophilic
NLS Segment(s)
PositionSequence
29-122RSRSRSPGASRRRRREDSYDRYESRGRRRDDSRDRYRRSRSSRSPPSRRDRRSPDTRDRGRPRNRSRSRSESPSYRRPRSRDGPVSRRPEQKKP
Subcellular Location(s) nucl 24, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013957  SNRNP27  
Gene Ontology GO:0005634  C:nucleus  
GO:0006397  P:mRNA processing  
GO:0008380  P:RNA splicing  
Pfam View protein in Pfam  
PF08648  SNRNP27  
Amino Acid Sequences MPRSPSPPSTKRYSSRQRERDYRDLDNPRSRSRSPGASRRRRREDSYDRYESRGRRRDDSRDRYRRSRSSRSPPSRRDRRSPDTRDRGRPRNRSRSRSESPSYRRPRSRDGPVSRRPEQKKPAEDKVEHMEQDDDQGEEDDEETKMMKLMGFGGFDTTKNKKVPGADVSGAKIHKPIKYRQYMNRRGGFNRPLDN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.78
3 0.83
4 0.84
5 0.86
6 0.88
7 0.87
8 0.83
9 0.79
10 0.77
11 0.76
12 0.75
13 0.74
14 0.71
15 0.68
16 0.68
17 0.62
18 0.59
19 0.55
20 0.56
21 0.55
22 0.6
23 0.64
24 0.69
25 0.78
26 0.82
27 0.87
28 0.83
29 0.81
30 0.82
31 0.82
32 0.8
33 0.79
34 0.77
35 0.69
36 0.67
37 0.66
38 0.62
39 0.61
40 0.6
41 0.55
42 0.53
43 0.57
44 0.64
45 0.69
46 0.73
47 0.73
48 0.76
49 0.78
50 0.8
51 0.83
52 0.81
53 0.79
54 0.79
55 0.77
56 0.77
57 0.82
58 0.84
59 0.85
60 0.85
61 0.87
62 0.87
63 0.84
64 0.83
65 0.81
66 0.79
67 0.8
68 0.79
69 0.79
70 0.79
71 0.8
72 0.8
73 0.79
74 0.8
75 0.79
76 0.81
77 0.8
78 0.81
79 0.83
80 0.79
81 0.79
82 0.78
83 0.73
84 0.7
85 0.64
86 0.62
87 0.6
88 0.64
89 0.65
90 0.64
91 0.64
92 0.61
93 0.65
94 0.63
95 0.66
96 0.65
97 0.66
98 0.67
99 0.7
100 0.73
101 0.71
102 0.74
103 0.7
104 0.68
105 0.68
106 0.67
107 0.68
108 0.67
109 0.7
110 0.68
111 0.63
112 0.59
113 0.56
114 0.51
115 0.42
116 0.36
117 0.29
118 0.21
119 0.23
120 0.19
121 0.13
122 0.1
123 0.1
124 0.09
125 0.08
126 0.09
127 0.07
128 0.07
129 0.07
130 0.07
131 0.07
132 0.07
133 0.07
134 0.07
135 0.06
136 0.09
137 0.1
138 0.1
139 0.1
140 0.13
141 0.13
142 0.14
143 0.19
144 0.21
145 0.25
146 0.26
147 0.28
148 0.28
149 0.3
150 0.35
151 0.35
152 0.37
153 0.35
154 0.35
155 0.36
156 0.38
157 0.35
158 0.3
159 0.3
160 0.27
161 0.28
162 0.31
163 0.38
164 0.44
165 0.53
166 0.61
167 0.66
168 0.73
169 0.79
170 0.84
171 0.82
172 0.77
173 0.72
174 0.73
175 0.7