Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4RCF8

Protein Details
Accession F4RCF8    Localization Confidence Medium Confidence Score 14.6
NoLS Segment(s)
PositionSequenceProtein Nature
12-39NLKVHRDGYGKKRRRLPCKKRQDAIDGVBasic
203-228DLELVKMKKRRKGNKKPRGYFHEIFFBasic
NLS Segment(s)
PositionSequence
22-27KKRRRL
208-220KMKKRRKGNKKPR
Subcellular Location(s) nucl 10.5, cyto_nucl 8.833, mito 7.5, cyto_mito 7.333, cyto 6
Family & Domain DBs
KEGG mlr:MELLADRAFT_60814  -  
Amino Acid Sequences MTVRVAHDSLGNLKVHRDGYGKKRRRLPCKKRQDAIDGVIAEEDEDLPDTNSSSTPIHIDLPEDDEVPPEDVETDHDSAGEECLAAAPDYDEDTEDQKDDHDPTLEIEPGKSKSTASAAYHTSGSRKKANQLNKLISKANFISRRVARSAAWRRHFSRTAKTMNLKVLPLTPGYNATRWNSEFDSLNRLVQARKVVNKLLADDLELVKMKKRRKGNKKPRGYFHEIFFAPDDWSALEELTTELAVSVPFLLIMLFPKLTV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.25
3 0.26
4 0.27
5 0.3
6 0.39
7 0.5
8 0.58
9 0.61
10 0.7
11 0.77
12 0.83
13 0.87
14 0.87
15 0.87
16 0.89
17 0.91
18 0.89
19 0.86
20 0.82
21 0.77
22 0.7
23 0.65
24 0.54
25 0.44
26 0.36
27 0.3
28 0.22
29 0.15
30 0.12
31 0.05
32 0.06
33 0.06
34 0.07
35 0.07
36 0.08
37 0.08
38 0.08
39 0.1
40 0.1
41 0.11
42 0.12
43 0.13
44 0.14
45 0.14
46 0.15
47 0.14
48 0.17
49 0.17
50 0.16
51 0.15
52 0.14
53 0.15
54 0.15
55 0.13
56 0.09
57 0.09
58 0.08
59 0.11
60 0.14
61 0.14
62 0.12
63 0.12
64 0.13
65 0.13
66 0.13
67 0.1
68 0.06
69 0.05
70 0.05
71 0.06
72 0.05
73 0.05
74 0.04
75 0.05
76 0.06
77 0.06
78 0.06
79 0.07
80 0.09
81 0.09
82 0.09
83 0.09
84 0.09
85 0.11
86 0.12
87 0.12
88 0.11
89 0.1
90 0.12
91 0.13
92 0.14
93 0.12
94 0.11
95 0.13
96 0.14
97 0.15
98 0.14
99 0.12
100 0.12
101 0.14
102 0.18
103 0.16
104 0.17
105 0.17
106 0.18
107 0.19
108 0.18
109 0.2
110 0.2
111 0.22
112 0.24
113 0.24
114 0.3
115 0.35
116 0.43
117 0.48
118 0.52
119 0.55
120 0.53
121 0.55
122 0.51
123 0.45
124 0.39
125 0.32
126 0.33
127 0.29
128 0.27
129 0.32
130 0.31
131 0.33
132 0.32
133 0.32
134 0.26
135 0.32
136 0.41
137 0.42
138 0.46
139 0.48
140 0.5
141 0.56
142 0.61
143 0.54
144 0.53
145 0.51
146 0.51
147 0.51
148 0.52
149 0.49
150 0.47
151 0.45
152 0.37
153 0.31
154 0.28
155 0.23
156 0.2
157 0.17
158 0.13
159 0.16
160 0.17
161 0.18
162 0.19
163 0.2
164 0.23
165 0.23
166 0.26
167 0.23
168 0.23
169 0.24
170 0.23
171 0.28
172 0.24
173 0.24
174 0.21
175 0.21
176 0.2
177 0.2
178 0.26
179 0.24
180 0.28
181 0.31
182 0.32
183 0.35
184 0.36
185 0.35
186 0.31
187 0.26
188 0.22
189 0.21
190 0.19
191 0.17
192 0.18
193 0.16
194 0.19
195 0.24
196 0.29
197 0.34
198 0.44
199 0.53
200 0.63
201 0.74
202 0.8
203 0.85
204 0.9
205 0.92
206 0.92
207 0.9
208 0.88
209 0.81
210 0.73
211 0.71
212 0.6
213 0.53
214 0.45
215 0.37
216 0.28
217 0.24
218 0.21
219 0.13
220 0.13
221 0.11
222 0.09
223 0.08
224 0.07
225 0.07
226 0.08
227 0.07
228 0.06
229 0.06
230 0.06
231 0.06
232 0.06
233 0.06
234 0.05
235 0.05
236 0.05
237 0.05
238 0.05
239 0.07
240 0.1