Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S2K8F0

Protein Details
Accession S2K8F0   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
100-133LAEAPKGGRKQRKEKKNREKKFRGVRKSKKPRKEBasic
NLS Segment(s)
PositionSequence
91-133PKHRLVRIGLAEAPKGGRKQRKEKKNREKKFRGVRKSKKPRKE
Subcellular Location(s) mito 16, nucl 6, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MQTADASTVTIRTRKFLTNRLLQRKQMVVDVIHPGLANVSKDELRTKIGKMYKSDKEVVSVFGFKTHFGGGKTTGFALIYDNVEALKKFEPKHRLVRIGLAEAPKGGRKQRKEKKNREKKFRGVRKSKKPRKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.35
3 0.4
4 0.45
5 0.51
6 0.61
7 0.68
8 0.71
9 0.67
10 0.67
11 0.63
12 0.56
13 0.49
14 0.41
15 0.32
16 0.28
17 0.29
18 0.24
19 0.2
20 0.19
21 0.15
22 0.14
23 0.14
24 0.12
25 0.08
26 0.1
27 0.1
28 0.11
29 0.14
30 0.14
31 0.16
32 0.17
33 0.18
34 0.23
35 0.26
36 0.29
37 0.32
38 0.38
39 0.39
40 0.42
41 0.44
42 0.37
43 0.36
44 0.33
45 0.3
46 0.24
47 0.2
48 0.16
49 0.15
50 0.15
51 0.12
52 0.13
53 0.11
54 0.11
55 0.1
56 0.12
57 0.11
58 0.12
59 0.12
60 0.11
61 0.11
62 0.09
63 0.08
64 0.08
65 0.08
66 0.07
67 0.07
68 0.07
69 0.07
70 0.08
71 0.07
72 0.08
73 0.1
74 0.14
75 0.16
76 0.23
77 0.3
78 0.35
79 0.46
80 0.5
81 0.52
82 0.49
83 0.54
84 0.49
85 0.45
86 0.43
87 0.34
88 0.28
89 0.23
90 0.24
91 0.21
92 0.22
93 0.27
94 0.33
95 0.4
96 0.51
97 0.61
98 0.7
99 0.78
100 0.86
101 0.89
102 0.92
103 0.94
104 0.94
105 0.94
106 0.93
107 0.93
108 0.93
109 0.92
110 0.92
111 0.92
112 0.93
113 0.94