Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S2JWJ1

Protein Details
Accession S2JWJ1    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
8-29KAQPAKGILKKHKNPNELTRLRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, cyto 2, mito 1, cysk 1, vacu 1, cyto_pero 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR007062  PPI-2  
Gene Ontology GO:0004864  F:protein phosphatase inhibitor activity  
GO:0043666  P:regulation of phosphoprotein phosphatase activity  
GO:0009966  P:regulation of signal transduction  
Pfam View protein in Pfam  
PF04979  IPP-2  
Amino Acid Sequences MSHSPNLKAQPAKGILKKHKNPNELTRLRWDEANLELTESQKDSTMKVDEPKTPYVRYDAESDQVLNLDEIPDIPYGAGSARAEPEEFTLDGGVESDKSSVTSHGEKSRRRVSVSDDDWEMDDDEKTEEEEEEAKKKHEEFLRKRANHYHMGAALRHQDDDDEEDESSGALPPPLPNHDTPMKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.59
3 0.67
4 0.74
5 0.76
6 0.79
7 0.78
8 0.8
9 0.8
10 0.81
11 0.74
12 0.7
13 0.69
14 0.65
15 0.59
16 0.54
17 0.44
18 0.36
19 0.34
20 0.34
21 0.24
22 0.2
23 0.19
24 0.18
25 0.19
26 0.17
27 0.15
28 0.14
29 0.15
30 0.13
31 0.17
32 0.19
33 0.2
34 0.25
35 0.28
36 0.3
37 0.34
38 0.39
39 0.39
40 0.37
41 0.36
42 0.34
43 0.32
44 0.29
45 0.29
46 0.24
47 0.22
48 0.22
49 0.21
50 0.17
51 0.15
52 0.14
53 0.09
54 0.08
55 0.06
56 0.05
57 0.05
58 0.06
59 0.06
60 0.06
61 0.05
62 0.05
63 0.05
64 0.05
65 0.07
66 0.05
67 0.06
68 0.07
69 0.07
70 0.08
71 0.08
72 0.09
73 0.09
74 0.08
75 0.08
76 0.07
77 0.07
78 0.06
79 0.06
80 0.05
81 0.04
82 0.04
83 0.04
84 0.04
85 0.05
86 0.05
87 0.06
88 0.09
89 0.11
90 0.14
91 0.22
92 0.28
93 0.3
94 0.37
95 0.44
96 0.44
97 0.43
98 0.42
99 0.41
100 0.45
101 0.44
102 0.4
103 0.33
104 0.31
105 0.29
106 0.29
107 0.22
108 0.13
109 0.1
110 0.08
111 0.08
112 0.08
113 0.08
114 0.08
115 0.07
116 0.08
117 0.11
118 0.12
119 0.17
120 0.18
121 0.19
122 0.21
123 0.22
124 0.28
125 0.31
126 0.4
127 0.43
128 0.52
129 0.62
130 0.62
131 0.66
132 0.68
133 0.67
134 0.63
135 0.58
136 0.51
137 0.45
138 0.45
139 0.41
140 0.36
141 0.37
142 0.3
143 0.28
144 0.23
145 0.2
146 0.19
147 0.22
148 0.2
149 0.15
150 0.14
151 0.14
152 0.14
153 0.13
154 0.12
155 0.1
156 0.09
157 0.07
158 0.08
159 0.1
160 0.14
161 0.19
162 0.23
163 0.23
164 0.29