Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S2IZN1

Protein Details
Accession S2IZN1    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
44-65NGYVHRPIRRPKKQQQTNFISTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 24, cyto_nucl 13.333, mito_nucl 13.333
Family & Domain DBs
Amino Acid Sequences MSTNSSSQQAPTQLETTPRVYYEHYMTAQPNYDLYPSLSRRLGNGYVHRPIRRPKKQQQTNFISTHGTTSRRSYNVDQDPLWQPIPQIQQEAPSWDLYPAILRNVENYGTDQMRQRLRVMEATVTTL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.31
3 0.3
4 0.27
5 0.25
6 0.23
7 0.24
8 0.26
9 0.25
10 0.26
11 0.25
12 0.26
13 0.27
14 0.27
15 0.26
16 0.23
17 0.2
18 0.16
19 0.15
20 0.13
21 0.14
22 0.19
23 0.19
24 0.23
25 0.24
26 0.23
27 0.24
28 0.27
29 0.28
30 0.26
31 0.3
32 0.31
33 0.36
34 0.41
35 0.41
36 0.41
37 0.46
38 0.53
39 0.56
40 0.61
41 0.64
42 0.71
43 0.79
44 0.82
45 0.83
46 0.8
47 0.77
48 0.68
49 0.59
50 0.49
51 0.4
52 0.34
53 0.27
54 0.21
55 0.16
56 0.18
57 0.21
58 0.21
59 0.25
60 0.25
61 0.32
62 0.35
63 0.37
64 0.34
65 0.34
66 0.36
67 0.35
68 0.33
69 0.24
70 0.18
71 0.21
72 0.25
73 0.22
74 0.21
75 0.19
76 0.22
77 0.22
78 0.26
79 0.22
80 0.18
81 0.18
82 0.15
83 0.15
84 0.12
85 0.14
86 0.11
87 0.12
88 0.13
89 0.13
90 0.14
91 0.17
92 0.17
93 0.15
94 0.17
95 0.2
96 0.19
97 0.21
98 0.25
99 0.29
100 0.34
101 0.35
102 0.35
103 0.34
104 0.36
105 0.39
106 0.37
107 0.35