Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S2JEE7

Protein Details
Accession S2JEE7    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
10-38KPSSSSGGKKAKKKWSAKKVKDKANNLVIHydrophilic
NLS Segment(s)
PositionSequence
10-32KPSSSSGGKKAKKKWSAKKVKDK
Subcellular Location(s) nucl 18, cyto 5, mito 3, cyto_pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MLAKKDVAGKPSSSSGGKKAKKKWSAKKVKDKANNLVILDKPTYDRLFKEVPTYKLISQSVLVDRLKLNGSLARIAIRELEAQGLIKAISRHHSQVIYTRATGDEKKPVAAEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.34
3 0.41
4 0.47
5 0.52
6 0.58
7 0.65
8 0.72
9 0.79
10 0.82
11 0.83
12 0.87
13 0.89
14 0.91
15 0.9
16 0.9
17 0.89
18 0.85
19 0.82
20 0.78
21 0.7
22 0.6
23 0.54
24 0.45
25 0.38
26 0.31
27 0.24
28 0.18
29 0.18
30 0.18
31 0.16
32 0.16
33 0.17
34 0.19
35 0.19
36 0.26
37 0.27
38 0.28
39 0.3
40 0.32
41 0.28
42 0.3
43 0.3
44 0.23
45 0.18
46 0.18
47 0.16
48 0.18
49 0.17
50 0.14
51 0.14
52 0.15
53 0.15
54 0.13
55 0.13
56 0.1
57 0.12
58 0.12
59 0.12
60 0.12
61 0.11
62 0.11
63 0.11
64 0.1
65 0.1
66 0.09
67 0.1
68 0.09
69 0.09
70 0.09
71 0.08
72 0.07
73 0.08
74 0.09
75 0.1
76 0.14
77 0.17
78 0.2
79 0.23
80 0.24
81 0.23
82 0.3
83 0.34
84 0.32
85 0.3
86 0.28
87 0.27
88 0.3
89 0.33
90 0.29
91 0.33
92 0.31
93 0.32