Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S2JLZ3

Protein Details
Accession S2JLZ3    Localization Confidence High Confidence Score 17.3
NoLS Segment(s)
PositionSequenceProtein Nature
4-23VHNINKIKGHSKDRKARIAKBasic
36-59VTTKRVITKKKQKQLEKALRHEKKBasic
NLS Segment(s)
PositionSequence
9-59KIKGHSKDRKARIAKSAAKAKRPTKPSVTTKRVITKKKQKQLEKALRHEKK
Subcellular Location(s) nucl 19, cyto 7
Family & Domain DBs
Amino Acid Sequences MGGVHNINKIKGHSKDRKARIAKSAAKAKRPTKPSVTTKRVITKKKQKQLEKALRHEKKLLASKGLIEYEEEMKDVVLPSPGRQRVMTACIPSDEVLAAAAAGPGTTLGGPQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.68
3 0.73
4 0.8
5 0.79
6 0.76
7 0.74
8 0.74
9 0.71
10 0.7
11 0.72
12 0.67
13 0.68
14 0.71
15 0.7
16 0.68
17 0.66
18 0.64
19 0.61
20 0.65
21 0.67
22 0.69
23 0.69
24 0.65
25 0.65
26 0.68
27 0.68
28 0.66
29 0.67
30 0.67
31 0.71
32 0.75
33 0.78
34 0.76
35 0.78
36 0.82
37 0.82
38 0.79
39 0.78
40 0.8
41 0.75
42 0.69
43 0.63
44 0.53
45 0.49
46 0.49
47 0.41
48 0.32
49 0.29
50 0.28
51 0.28
52 0.26
53 0.2
54 0.13
55 0.13
56 0.13
57 0.13
58 0.12
59 0.09
60 0.09
61 0.09
62 0.09
63 0.08
64 0.09
65 0.09
66 0.12
67 0.2
68 0.23
69 0.24
70 0.24
71 0.26
72 0.26
73 0.31
74 0.33
75 0.26
76 0.25
77 0.24
78 0.25
79 0.23
80 0.21
81 0.15
82 0.11
83 0.09
84 0.08
85 0.06
86 0.05
87 0.05
88 0.04
89 0.04
90 0.04
91 0.03
92 0.04