Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1D8PPN6

Protein Details
Accession A0A1D8PPN6    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
2-32ATSVPHPKIVKKYTKKFKRHHSDRYHRVAENHydrophilic
NLS Segment(s)
PositionSequence
15-20TKKFKR
Subcellular Location(s) mito 15.5, mito_nucl 13, nucl 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG cal:CAALFM_C601700WA  -  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MATSVPHPKIVKKYTKKFKRHHSDRYHRVAENWRKQKGIDSCVRRRFRGTIPQPNIGYGSNKKTKFLNPAGYKVYLVKNVKDLDVLLLHTKSYAAEIASSVSSRKRVEIVAKAKKLGVKVTNPKGKLNLEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.84
3 0.88
4 0.88
5 0.9
6 0.91
7 0.9
8 0.9
9 0.9
10 0.91
11 0.9
12 0.9
13 0.85
14 0.74
15 0.69
16 0.69
17 0.68
18 0.68
19 0.67
20 0.6
21 0.55
22 0.54
23 0.58
24 0.53
25 0.5
26 0.48
27 0.49
28 0.55
29 0.64
30 0.68
31 0.61
32 0.58
33 0.55
34 0.52
35 0.54
36 0.53
37 0.54
38 0.55
39 0.6
40 0.56
41 0.52
42 0.48
43 0.38
44 0.33
45 0.25
46 0.27
47 0.28
48 0.28
49 0.28
50 0.29
51 0.31
52 0.35
53 0.37
54 0.4
55 0.35
56 0.38
57 0.4
58 0.38
59 0.36
60 0.31
61 0.28
62 0.25
63 0.24
64 0.21
65 0.23
66 0.24
67 0.23
68 0.21
69 0.19
70 0.14
71 0.13
72 0.14
73 0.11
74 0.11
75 0.1
76 0.1
77 0.1
78 0.08
79 0.08
80 0.08
81 0.06
82 0.06
83 0.07
84 0.08
85 0.08
86 0.09
87 0.09
88 0.11
89 0.15
90 0.15
91 0.17
92 0.17
93 0.2
94 0.26
95 0.35
96 0.43
97 0.49
98 0.51
99 0.51
100 0.52
101 0.51
102 0.47
103 0.45
104 0.41
105 0.41
106 0.48
107 0.57
108 0.63
109 0.63
110 0.65
111 0.63