Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S2JGN0

Protein Details
Accession S2JGN0    Localization Confidence Medium Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
213-236VGLFFFCRKRREKKKENMANAFFEHydrophilic
NLS Segment(s)
PositionSequence
221-226KRREKK
Subcellular Location(s) nucl 17, cyto 2, plas 2, extr 2, golg 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MVLIKRETSSEDSGNYATVTTKYGSTPTNNNNNNNNNSNNSNNNSGYNSNMGNNGNNGYNNNNGAGGNGGYNSNGNGYSNNNNNNGYNNYNNGGNNGYSSFPSSPNNSNGYNTNNNGNSNSNNIPVGNNNNNNNNNNGYNSNNNNVPYNSNNNNNWPVANNNNNNGYSANNGYNNNAPSYLPNDYGDQGGKMNAKVVIIVVSVICGVGLLAAVGLFFFCRKRREKKKENMANAFFEFSADKSDDLKKVKSPGALKKKFQSSPVSTL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.23
3 0.18
4 0.14
5 0.13
6 0.14
7 0.12
8 0.13
9 0.13
10 0.16
11 0.19
12 0.22
13 0.3
14 0.36
15 0.45
16 0.51
17 0.56
18 0.62
19 0.66
20 0.68
21 0.65
22 0.59
23 0.53
24 0.51
25 0.5
26 0.47
27 0.43
28 0.42
29 0.38
30 0.37
31 0.36
32 0.32
33 0.29
34 0.26
35 0.24
36 0.2
37 0.22
38 0.21
39 0.19
40 0.2
41 0.19
42 0.18
43 0.18
44 0.18
45 0.17
46 0.18
47 0.18
48 0.17
49 0.16
50 0.14
51 0.13
52 0.13
53 0.1
54 0.08
55 0.08
56 0.07
57 0.07
58 0.07
59 0.07
60 0.07
61 0.07
62 0.07
63 0.08
64 0.11
65 0.16
66 0.21
67 0.24
68 0.26
69 0.27
70 0.27
71 0.29
72 0.29
73 0.27
74 0.24
75 0.22
76 0.21
77 0.22
78 0.21
79 0.19
80 0.18
81 0.14
82 0.13
83 0.12
84 0.12
85 0.1
86 0.12
87 0.12
88 0.13
89 0.15
90 0.18
91 0.2
92 0.23
93 0.26
94 0.24
95 0.24
96 0.25
97 0.28
98 0.28
99 0.26
100 0.27
101 0.25
102 0.25
103 0.25
104 0.24
105 0.2
106 0.2
107 0.2
108 0.16
109 0.15
110 0.15
111 0.13
112 0.13
113 0.18
114 0.2
115 0.23
116 0.24
117 0.3
118 0.33
119 0.33
120 0.33
121 0.3
122 0.25
123 0.23
124 0.22
125 0.18
126 0.19
127 0.2
128 0.2
129 0.2
130 0.2
131 0.2
132 0.19
133 0.2
134 0.18
135 0.23
136 0.24
137 0.27
138 0.28
139 0.3
140 0.32
141 0.3
142 0.28
143 0.22
144 0.22
145 0.22
146 0.29
147 0.27
148 0.27
149 0.3
150 0.3
151 0.3
152 0.27
153 0.22
154 0.17
155 0.17
156 0.17
157 0.16
158 0.17
159 0.18
160 0.21
161 0.21
162 0.2
163 0.18
164 0.15
165 0.14
166 0.17
167 0.18
168 0.16
169 0.16
170 0.17
171 0.17
172 0.18
173 0.17
174 0.14
175 0.12
176 0.13
177 0.14
178 0.12
179 0.13
180 0.12
181 0.12
182 0.11
183 0.11
184 0.09
185 0.08
186 0.08
187 0.06
188 0.05
189 0.05
190 0.05
191 0.04
192 0.03
193 0.03
194 0.02
195 0.02
196 0.02
197 0.02
198 0.02
199 0.02
200 0.02
201 0.02
202 0.03
203 0.04
204 0.08
205 0.13
206 0.2
207 0.29
208 0.4
209 0.52
210 0.63
211 0.72
212 0.8
213 0.87
214 0.9
215 0.92
216 0.92
217 0.85
218 0.79
219 0.7
220 0.61
221 0.49
222 0.4
223 0.3
224 0.2
225 0.2
226 0.16
227 0.15
228 0.16
229 0.22
230 0.27
231 0.31
232 0.34
233 0.34
234 0.39
235 0.43
236 0.46
237 0.49
238 0.54
239 0.61
240 0.66
241 0.68
242 0.71
243 0.76
244 0.73
245 0.71
246 0.7